{"search": {"jaspar_id": ["MA0861.2"], "uniprot_names": ["Tumor protein p73"], "go_ids": ["0019901", "0003700", "0010243", "0000785", "0061629", "0001822", "0060044", "0045893", "0043410", "0010468", "0048714", "0051726", "0001228", "0005829", "0008285", "0097371", "0002039", "1901248", "0000981", "0007346", "0043231", "0005794", "0005654", "0042802", "0000978", "0045944", "0045665", "0042771", "0000976", "0006974", "0043065", "0006357", "0140297", "0009410", "0008630", "0046872", "0030054", "0051262", "0005634", "0001222", "0006298"], "organisms": ["Homo sapiens"], "genes": ["TP73"], "uniprot_ids": [{"uniprot_accession": "O15350", "go_ids": ["0019901", "0003700", "0010243", "0000785", "0061629", "0001822", "0060044", "0045893", "0043410", "0010468", "0048714", "0051726", "0001228", "0005829", "0008285", "0097371", "0002039", "1901248", "0000981", "0007346", "0043231", "0005794", "0005654", "0042802", "0000978", "0045944", "0045665", "0042771", "0000976", "0006974", "0043065", "0006357", "0140297", "0009410", "0008630", "0046872", "0030054", "0051262", "0005634", "0001222", "0006298"]}], "GO_molecular_function": [["DNA damage response", "0006974"], ["intrinsic apoptotic signaling pathway in response to DNA damage", "0008630"], ["intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator", "0042771"], ["kidney development", "0001822"], ["mismatch repair", "0006298"], ["negative regulation of cardiac muscle cell proliferation", "0060044"], ["negative regulation of cell population proliferation", "0008285"], ["negative regulation of neuron differentiation", "0045665"], ["positive regulation of apoptotic process", "0043065"], ["positive regulation of DNA-templated transcription", "0045893"], ["positive regulation of lung ciliated cell differentiation", "1901248"], ["positive regulation of MAPK cascade", "0043410"], ["positive regulation of oligodendrocyte differentiation", "0048714"], ["positive regulation of transcription by RNA polymerase II", "0045944"], ["protein tetramerization", "0051262"], ["regulation of cell cycle", "0051726"], ["regulation of gene expression", "0010468"], ["regulation of mitotic cell cycle", "0007346"], ["regulation of transcription by RNA polymerase II", "0006357"], ["response to organonitrogen compound", "0010243"], ["response to xenobiotic stimulus", "0009410"]], "organism": "Homo sapiens"}, "dna": {"models": [{"pairs": [{"origin": [-21.978, -31.864, 24.158], "dssr_description": "cW-W", "z_axis": [-0.142, -0.091, -0.986], "pair_type": "watson-crick", "id2": "F.419. ", "id1": "E.400. ", "name2": "DC", "mismatched": false, "name1": "DG", "y_axis": [0.978, 0.142, -0.154], "hbonds": [{"distance": 3.11, "atom1": "O6", "atom2": "N4"}, {"distance": 2.93, "atom1": "N1", "atom2": "N3"}, {"distance": 2.69, "atom1": "N2", "atom2": "O2"}], "id": "E.400. @F.419. ", "x_axis": [-0.154, 0.986, -0.069]}, {"origin": [-21.515, -32.632, 20.558], "dssr_description": "cW-W", "z_axis": [-0.111, 0.059, -0.992], "pair_type": "watson-crick", "id2": "F.418. ", "id1": "E.401. ", "name2": "DT", "mismatched": false, "name1": "DA", "y_axis": [0.878, -0.462, -0.126], "hbonds": [{"distance": 3.65, "atom1": "N6", "atom2": "O4"}, {"distance": 3.24, "atom1": "N1", "atom2": "N3"}], "id": "E.401. @F.418. ", "x_axis": [0.466, 0.885, 0.001]}, {"origin": [-21.699, -32.563, 17.547], "dssr_description": "cW-W", "z_axis": [-0.06, 0.028, -0.998], "pair_type": "watson-crick", "id2": "F.417. ", "id1": "E.402. ", "name2": "DT", "mismatched": false, "name1": "DA", "y_axis": [0.454, -0.89, -0.052], "hbonds": [{"distance": 3.04, "atom1": "N6", "atom2": "O4"}, {"distance": 2.75, "atom1": "N1", "atom2": "N3"}], "id": "E.402. @F.417. ", "x_axis": [0.889, 0.456, -0.041]}, {"origin": [-22.38, -31.9, 14.24], "dssr_description": "cW-W", "z_axis": [0.003, -0.006, -1.0], "pair_type": "watson-crick", "id2": "F.416. ", "id1": "E.403. ", "name2": "DG", "mismatched": false, "name1": "DC", "y_axis": [-0.196, -0.981, 0.006], "hbonds": [{"distance": 3.18, "atom1": "O2", "atom2": "N2"}, {"distance": 3.07, "atom1": "N3", "atom2": "N1"}, {"distance": 2.92, "atom1": "N4", "atom2": "O6"}], "id": "E.403. @F.416. ", "x_axis": [0.981, -0.196, 0.004]}, {"origin": [-22.303, -32.916, 10.14], "dssr_description": "cW-W", "z_axis": [-0.056, 0.028, -0.998], "pair_type": "watson-crick", "id2": "F.415. ", "id1": "E.404. ", "name2": "DG", "mismatched": false, "name1": "DC", "y_axis": [-0.771, -0.636, 0.025], "hbonds": [{"distance": 2.51, "atom1": "O2", "atom2": "N2"}, {"distance": 2.89, "atom1": "N3", "atom2": "N1"}, {"distance": 3.14, "atom1": "N4", "atom2": "O6"}], "id": "E.404. @F.415. ", "x_axis": [0.634, -0.771, -0.058]}, {"origin": [-23.059, -33.429, 7.107], "dssr_description": "cW-W", "z_axis": [-0.081, 0.015, -0.997], "pair_type": "watson-crick", "id2": "F.414. ", "id1": "E.405. ", "name2": "DC", "mismatched": false, "name1": "DG", "y_axis": [-0.958, -0.279, 0.074], "hbonds": [{"distance": 3.44, "atom1": "O6", "atom2": "N4"}, {"distance": 2.96, "atom1": "N1", "atom2": "N3"}, {"distance": 2.43, "atom1": "N2", "atom2": "O2"}], "id": "E.405. @F.414. ", "x_axis": [0.277, -0.96, -0.037]}, {"origin": [-23.653, -32.894, 3.964], "dssr_description": "cW-W", "z_axis": [-0.121, -0.047, -0.992], "pair_type": "watson-crick", "id2": "F.413. ", "id1": "E.406. ", "name2": "DC", "mismatched": false, "name1": "DG", "y_axis": [-0.914, 0.396, 0.092], "hbonds": [{"distance": 3.5, "atom1": "O6", "atom2": "N4"}, {"distance": 3.33, "atom1": "N1", "atom2": "N3"}, {"distance": 3.18, "atom1": "N2", "atom2": "O2"}], "id": "E.406. @F.413. ", "x_axis": [-0.388, -0.917, 0.091]}, {"origin": [-23.319, -33.51, 0.162], "dssr_description": "cW-W", "z_axis": [-0.117, -0.025, -0.993], "pair_type": "watson-crick", "id2": "F.412. ", "id1": "E.407. ", "name2": "DA", "mismatched": false, "name1": "DT", "y_axis": [-0.517, 0.855, 0.04], "hbonds": [{"distance": 3.08, "atom1": "N3", "atom2": "N1"}, {"distance": 3.42, "atom1": "O4", "atom2": "N6"}], "id": "E.407. @F.412. ", "x_axis": [-0.848, -0.518, 0.113]}, {"origin": [-23.732, -33.501, -2.846], "dssr_description": "cW-W", "z_axis": [-0.027, -0.111, -0.993], "pair_type": "watson-crick", "id2": "F.411. ", "id1": "E.408. ", "name2": "DA", "mismatched": false, "name1": "DT", "y_axis": [0.095, 0.989, -0.113], "hbonds": [{"distance": 2.99, "atom1": "N3", "atom2": "N1"}, {"distance": 3.66, "atom1": "O4", "atom2": "N6"}], "id": "E.408. @F.411. ", "x_axis": [-0.995, 0.098, 0.016]}, {"origin": [-22.959, -33.749, -6.528], "dssr_description": "cW-W", "z_axis": [-0.041, -0.046, -0.998], "pair_type": "watson-crick", "id2": "F.410. ", "id1": "E.409. ", "name2": "DG", "mismatched": false, "name1": "DC", "y_axis": [0.699, 0.712, -0.062], "hbonds": [{"distance": 3.06, "atom1": "O2", "atom2": "N2"}, {"distance": 2.86, "atom1": "N3", "atom2": "N1"}, {"distance": 2.56, "atom1": "N4", "atom2": "O6"}], "id": "E.409. @F.410. ", "x_axis": [-0.714, 0.7, -0.003]}, {"origin": [-21.978, -31.864, -10.19], "dssr_description": "cW-W", "z_axis": [-0.142, -0.091, -0.986], "pair_type": "watson-crick", "id2": "D.419. ", "id1": "C.400. ", "name2": "DC", "mismatched": false, "name1": "DG", "y_axis": [0.978, 0.142, -0.154], "hbonds": [{"distance": 3.11, "atom1": "O6", "atom2": "N4"}, {"distance": 2.93, "atom1": "N1", "atom2": "N3"}, {"distance": 2.69, "atom1": "N2", "atom2": "O2"}], "id": "C.400. @D.419. ", "x_axis": [-0.154, 0.986, -0.069]}, {"origin": [-21.515, -32.632, -13.79], "dssr_description": "cW-W", "z_axis": [-0.111, 0.059, -0.992], "pair_type": "watson-crick", "id2": "D.418. ", "id1": "C.401. ", "name2": "DT", "mismatched": false, "name1": "DA", "y_axis": [0.878, -0.462, -0.126], "hbonds": [{"distance": 3.65, "atom1": "N6", "atom2": "O4"}, {"distance": 3.24, "atom1": "N1", "atom2": "N3"}], "id": "C.401. @D.418. ", "x_axis": [0.466, 0.885, 0.001]}, {"origin": [-21.699, -32.563, -16.801], "dssr_description": "cW-W", "z_axis": [-0.06, 0.028, -0.998], "pair_type": "watson-crick", "id2": "D.417. ", "id1": "C.402. ", "name2": "DT", "mismatched": false, "name1": "DA", "y_axis": [0.454, -0.89, -0.052], "hbonds": [{"distance": 3.04, "atom1": "N6", "atom2": "O4"}, {"distance": 2.75, "atom1": "N1", "atom2": "N3"}], "id": "C.402. @D.417. ", "x_axis": [0.889, 0.456, -0.041]}, {"origin": [-22.38, -31.9, -20.108], "dssr_description": "cW-W", "z_axis": [0.003, -0.006, -1.0], "pair_type": "watson-crick", "id2": "D.416. ", "id1": "C.403. ", "name2": "DG", "mismatched": false, "name1": "DC", "y_axis": [-0.196, -0.981, 0.006], "hbonds": [{"distance": 3.18, "atom1": "O2", "atom2": "N2"}, {"distance": 3.07, "atom1": "N3", "atom2": "N1"}, {"distance": 2.92, "atom1": "N4", "atom2": "O6"}], "id": "C.403. @D.416. ", "x_axis": [0.981, -0.196, 0.004]}, {"origin": [-22.303, -32.916, -24.208], "dssr_description": "cW-W", "z_axis": [-0.056, 0.028, -0.998], "pair_type": "watson-crick", "id2": "D.415. ", "id1": "C.404. ", "name2": "DG", "mismatched": false, "name1": "DC", "y_axis": [-0.771, -0.636, 0.025], "hbonds": [{"distance": 2.51, "atom1": "O2", "atom2": "N2"}, {"distance": 2.89, "atom1": "N3", "atom2": "N1"}, {"distance": 3.14, "atom1": "N4", "atom2": "O6"}], "id": "C.404. @D.415. ", "x_axis": [0.634, -0.771, -0.058]}, {"origin": [-23.059, -33.429, -27.241], "dssr_description": "cW-W", "z_axis": [-0.081, 0.015, -0.997], "pair_type": "watson-crick", "id2": "D.414. ", "id1": "C.405. ", "name2": "DC", "mismatched": false, "name1": "DG", "y_axis": [-0.958, -0.279, 0.074], "hbonds": [{"distance": 3.44, "atom1": "O6", "atom2": "N4"}, {"distance": 2.96, "atom1": "N1", "atom2": "N3"}, {"distance": 2.43, "atom1": "N2", "atom2": "O2"}], "id": "C.405. @D.414. ", "x_axis": [0.277, -0.96, -0.037]}, {"origin": [-23.653, -32.894, -30.384], "dssr_description": "cW-W", "z_axis": [-0.121, -0.047, -0.992], "pair_type": "watson-crick", "id2": "D.413. ", "id1": "C.406. ", "name2": "DC", "mismatched": false, "name1": "DG", "y_axis": [-0.914, 0.396, 0.092], "hbonds": [{"distance": 3.5, "atom1": "O6", "atom2": "N4"}, {"distance": 3.33, "atom1": "N1", "atom2": "N3"}, {"distance": 3.18, "atom1": "N2", "atom2": "O2"}], "id": "C.406. @D.413. ", "x_axis": [-0.388, -0.917, 0.091]}, {"origin": [-23.319, -33.51, -34.186], "dssr_description": "cW-W", "z_axis": [-0.117, -0.025, -0.993], "pair_type": "watson-crick", "id2": "D.412. ", "id1": "C.407. ", "name2": "DA", "mismatched": false, "name1": "DT", "y_axis": [-0.517, 0.855, 0.04], "hbonds": [{"distance": 3.08, "atom1": "N3", "atom2": "N1"}, {"distance": 3.42, "atom1": "O4", "atom2": "N6"}], "id": "C.407. @D.412. ", "x_axis": [-0.848, -0.518, 0.113]}, {"origin": [-23.732, -33.501, -37.194], "dssr_description": "cW-W", "z_axis": [-0.027, -0.111, -0.993], "pair_type": "watson-crick", "id2": "D.411. ", "id1": "C.408. ", "name2": "DA", "mismatched": false, "name1": "DT", "y_axis": [0.095, 0.989, -0.113], "hbonds": [{"distance": 2.99, "atom1": "N3", "atom2": "N1"}, {"distance": 3.66, "atom1": "O4", "atom2": "N6"}], "id": "C.408. @D.411. ", "x_axis": [-0.995, 0.098, 0.016]}, {"origin": [-22.959, -33.749, -40.876], "dssr_description": "cW-W", "z_axis": [-0.041, -0.046, -0.998], "pair_type": "watson-crick", "id2": "D.410. ", "id1": "C.409. ", "name2": "DG", "mismatched": false, "name1": "DC", "y_axis": [0.699, 0.712, -0.062], "hbonds": [{"distance": 3.06, "atom1": "O2", "atom2": "N2"}, {"distance": 2.86, "atom1": "N3", "atom2": "N1"}, {"distance": 2.56, "atom1": "N4", "atom2": "O6"}], "id": "C.409. @D.410. ", "x_axis": [-0.714, 0.7, -0.003]}], "links": [{"3p_atom": "O3'", "link_distance": 1.6127798557281494, "3p_nuc_id": "C.403. ", "5p_nuc_id": "C.404. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.5966993570327759, "3p_nuc_id": "C.404. ", "5p_nuc_id": "C.405. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6025441884994507, "3p_nuc_id": "D.418. ", "5p_nuc_id": "D.419. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6043204069137573, "3p_nuc_id": "D.410. ", "5p_nuc_id": "D.411. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.606813907623291, "3p_nuc_id": "C.402. ", "5p_nuc_id": "C.403. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6127806901931763, "3p_nuc_id": "E.403. ", "5p_nuc_id": "E.404. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.5966989994049072, "3p_nuc_id": "E.404. ", "5p_nuc_id": "E.405. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6025441884994507, "3p_nuc_id": "F.418. ", "5p_nuc_id": "F.419. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6043200492858887, "3p_nuc_id": "F.410. ", "5p_nuc_id": "F.411. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6068147420883179, "3p_nuc_id": "E.402. ", "5p_nuc_id": "E.403. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.607416033744812, "3p_nuc_id": "C.405. ", "5p_nuc_id": "C.406. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6057133674621582, "3p_nuc_id": "D.417. ", "5p_nuc_id": "D.418. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.610507607460022, "3p_nuc_id": "D.416. ", "5p_nuc_id": "D.417. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6079427003860474, "3p_nuc_id": "C.406. ", "5p_nuc_id": "C.407. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6074167490005493, "3p_nuc_id": "E.405. ", "5p_nuc_id": "E.406. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.605714201927185, "3p_nuc_id": "F.417. ", "5p_nuc_id": "F.418. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.610507607460022, "3p_nuc_id": "F.416. ", "5p_nuc_id": "F.417. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.60794198513031, "3p_nuc_id": "E.406. ", "5p_nuc_id": "E.407. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6042225360870361, "3p_nuc_id": "D.411. ", "5p_nuc_id": "D.412. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.604724407196045, "3p_nuc_id": "C.401. ", "5p_nuc_id": "C.402. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6060899496078491, "3p_nuc_id": "D.412. ", "5p_nuc_id": "D.413. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.5981374979019165, "3p_nuc_id": "C.400. ", "5p_nuc_id": "C.401. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6042230129241943, "3p_nuc_id": "F.411. ", "5p_nuc_id": "F.412. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.604724407196045, "3p_nuc_id": "E.401. ", "5p_nuc_id": "E.402. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6060881614685059, "3p_nuc_id": "F.412. ", "5p_nuc_id": "F.413. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.5981369018554688, "3p_nuc_id": "E.400. ", "5p_nuc_id": "E.401. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6211473941802979, "3p_nuc_id": "C.407. ", "5p_nuc_id": "C.408. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6036043167114258, "3p_nuc_id": "D.415. ", "5p_nuc_id": "D.416. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.5967493057250977, "3p_nuc_id": "D.413. ", "5p_nuc_id": "D.414. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6018306016921997, "3p_nuc_id": "C.408. ", "5p_nuc_id": "C.409. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6039186716079712, "3p_nuc_id": "D.414. ", "5p_nuc_id": "D.415. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.62114679813385, "3p_nuc_id": "E.407. ", "5p_nuc_id": "E.408. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.6036036014556885, "3p_nuc_id": "F.415. ", "5p_nuc_id": "F.416. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.5967495441436768, "3p_nuc_id": "F.413. ", "5p_nuc_id": "F.414. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.601831078529358, "3p_nuc_id": "E.408. ", "5p_nuc_id": "E.409. ", "5p_atom": "P"}, {"3p_atom": "O3'", "link_distance": 1.603918194770813, "3p_nuc_id": "F.414. ", "5p_nuc_id": "F.415. ", "5p_atom": "P"}], "num_entities": 1, "entities": [{"visualization": {"contains_pseudoknots": false, "dbn": "(((((((((((((((((((())))))))))))))))))))", "radial": {"link_distance": 0.1052631578771251}, "rnascape": {"link_distance": 0.10520800214817266}, "circular": {"link_distance": 1.0}}, "pairs": ["E.400. @F.419. ", "E.401. @F.418. ", "E.402. @F.417. ", "E.403. @F.416. ", "E.404. @F.415. ", "E.405. @F.414. ", "E.406. @F.413. ", "E.407. @F.412. ", "E.408. @F.411. ", "E.409. @F.410. ", "C.400. @D.419. ", "C.401. @D.418. ", "C.402. @D.417. ", "C.403. @D.416. ", "C.404. @D.415. ", "C.405. @D.414. ", "C.406. @D.413. ", "C.407. @D.412. ", "C.408. @D.411. ", "C.409. @D.410. "], "type": "perfect_helix", "chemical_modifications": {"5_methylated_cytosine": false, "non-standard_nucleotides": false}, "helical_segments": [{"helix_id": "E400/409F410/419C400/409D410/419", "mean_radius": 9.183, "sequence2": "CTTGGCCAAGCTTGGCCAAG", "classification": "B-DNA", "contains_non-wc_pairs": false, "chemical_modifications": {"5_methylated_cytosine": false, "non-standard_nucleotides": false}, "multiplets": [], "handedness": "Right-Handed", "helical_axis": {"bp_origin_y": [-31.864, -32.632, -32.563, -31.9, -32.916, -33.429, -32.894, -33.51, -33.501, -33.749, -31.864, -32.632, -32.563, -31.9, -32.916, -33.429, -32.894, -33.51, -33.501, -33.749], "bp_origin_x": [-21.978, -21.515, -21.699, -22.38, -22.303, -23.059, -23.653, -23.319, -23.732, -22.959, -21.978, -21.515, -21.699, -22.38, -22.303, -23.059, -23.653, -23.319, -23.732, -22.959], "bp_origin_z": [24.158, 20.558, 17.547, 14.24, 10.14, 7.107, 3.964, 0.162, -2.846, -6.528, -10.19, -13.79, -16.801, -20.108, -24.208, -27.241, -30.384, -34.186, -37.194, -40.876], "z_coef": [-8.33989506173494, -0.964643182398349], "axis_length": 67.1866609511334, "x_coef": [-22.659956127564424, -0.015350777332465959], "y_coef": [-32.89601899456037, -0.013125243825005434], "axis_curvature": "linear"}, "contains_hoogsteen_pairs": false, "contains_mismatches": false, "length": 20, "score": 1.0, "sequence1": "GAACCGGTTCGAACCGGTTC", "contains_non-standard_pairs": false, "contains_A-tracts": false, "GC_content": 0.6, "ids2": ["F.419. ", "F.418. ", "F.417. ", "F.416. ", "F.415. ", "F.414. ", "F.413. ", "F.412. ", "F.411. ", "F.410. ", "D.419. ", "D.418. ", "D.417. ", "D.416. ", "D.415. ", "D.414. ", "D.413. ", "D.412. ", "D.411. ", "D.410. "], "shape_parameters": {"twist": [35.76, 35.19, 38.4, 39.18, 23.39, 39.51, 35.44, 37.2, 38.8, 36.9, 35.76, 35.19, 38.4, 39.18, 23.39, 39.51, 35.44, 37.2, 38.8], "major_groove_curves": ["NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA"], "opening": [4.85, 6.41, 2.04, -4.47, 6.38, 8.82, 0.53, 3.76, 13.04, -8.02, 4.85, 6.41, 2.04, -4.47, 6.38, 8.82, 0.53, 3.76, 13.04, -8.02], "minor_groove_curves": ["NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA", "NA"], "shift": [-0.55, 0.01, -0.49, 0.7, 0.26, -0.57, -0.15, 0.14, -0.8, 1.3, -0.55, 0.01, -0.49, 0.7, 0.26, -0.57, -0.15, 0.14, -0.8], "buckle": [13.91, 6.25, 3.79, -3.1, -4.33, 6.78, 6.88, -4.95, 6.99, -5.62, 13.91, 6.25, 3.79, -3.1, -4.33, 6.78, 6.88, -4.95, 6.99, -5.62], "rise": [3.52, 3.02, 3.33, 4.09, 3.07, 3.18, 3.76, 3.02, 3.66, 3.42, 3.52, 3.02, 3.33, 4.09, 3.07, 3.18, 3.76, 3.02, 3.66], "stagger": [-0.23, -0.04, 0.25, 0.11, 0.55, 1.0, 0.57, 0.47, -0.16, -0.05, -0.23, -0.04, 0.25, 0.11, 0.55, 1.0, 0.57, 0.47, -0.16, -0.05], "minor_groove_3dna": ["NA", "NA", "NA", 6.4, 7.6, 6.3, 4.5, 5.6, 7.3, 7.7, 6.6, 4.8, 4.7, 6.4, 7.6, 6.3, "NA", "NA", "NA"], "stretch": [-0.06, 0.31, -0.18, -0.12, -0.15, -0.09, 0.28, 0.13, 0.16, -0.19, -0.06, 0.31, -0.18, -0.12, -0.15, -0.09, 0.28, 0.13, 0.16, -0.19], "slide": [1.02, 0.1, -0.7, 0.82, 0.75, 0.31, -0.91, 0.25, 0.42, 2.13, 1.02, 0.1, -0.7, 0.82, 0.75, 0.31, -0.91, 0.25, 0.42], "tilt": [-0.32, -3.35, -2.45, -0.04, -1.62, -2.05, -0.68, 5.95, -3.04, 6.36, -0.32, -3.35, -2.45, -0.04, -1.62, -2.05, -0.68, 5.95, -3.04], "propeller": [-3.25, -21.94, -14.87, -11.03, -2.81, -9.8, -16.36, -2.55, -16.03, -4.68, -3.25, -21.94, -14.87, -11.03, -2.81, -9.8, -16.36, -2.55, -16.03, -4.68], "major_groove_3dna": ["NA", "NA", "NA", 12.1, 11.0, 12.2, 12.2, 11.7, 12.0, 9.9, 11.4, 9.3, 12.2, 12.1, 11.0, 12.2, "NA", "NA", "NA"], "roll": [8.83, 0.82, 3.33, -3.94, -0.01, 3.72, -1.13, -3.92, 2.32, 0.29, 8.83, 0.82, 3.33, -3.94, -0.01, 3.72, -1.13, -3.92, 2.32], "shear": [-0.13, 0.69, 0.19, 0.61, 0.49, -0.39, -0.32, -0.45, -0.51, -0.6, -0.13, 0.69, 0.19, 0.61, 0.49, -0.39, -0.32, -0.45, -0.51, -0.6]}, "ids1": ["E.400. ", "E.401. ", "E.402. ", "E.403. ", "E.404. ", "E.405. ", "E.406. ", "E.407. ", "E.408. ", "E.409. ", "C.400. ", "C.401. ", "C.402. ", "C.403. ", "C.404. ", "C.405. ", "C.406. ", "C.407. ", "C.408. ", "C.409. "]}], "stacks": ["E.400. @E.401. ", "E.401. @E.402. ", "E.402. @E.403. ", "E.403. @E.404. ", "E.404. @E.405. ", "E.405. @E.406. ", "E.406. @E.407. ", "E.407. @E.408. ", "E.408. @E.409. ", "C.400. @E.409. ", "C.400. @C.401. ", "F.410. @F.411. ", "D.419. @F.410. ", "F.411. @F.412. ", "D.418. @D.419. ", "F.412. @F.413. ", "F.413. @F.414. ", "F.414. @F.415. ", "F.415. @F.416. ", "F.416. @F.417. ", "F.417. @F.418. ", "F.418. @F.419. ", "C.401. @C.402. ", "C.402. @C.403. ", "C.403. @C.404. ", "C.404. @C.405. ", "C.405. @C.406. ", "C.406. @C.407. ", "C.407. @C.408. ", "C.408. @C.409. ", "D.410. @D.411. ", "D.411. @D.412. ", "D.412. @D.413. ", "D.413. @D.414. ", "D.414. @D.415. ", "D.415. @D.416. ", "D.416. @D.417. ", "D.417. @D.418. "], "num_nucleotides": 40, "num_strands": 4, "num_single-stranded_segments": 0, "nucleotides": ["E.400. ", "E.401. ", "E.402. ", "E.403. ", "E.404. ", "E.405. ", "E.406. ", "E.407. ", "E.408. ", "E.409. ", "C.400. ", "C.401. ", "C.402. ", "C.403. ", "C.404. ", "C.405. ", "C.406. ", "C.407. ", "C.408. ", "C.409. ", "D.410. ", "D.411. ", "D.412. ", "D.413. ", "D.414. ", "D.415. ", "D.416. ", "D.417. ", "D.418. ", "D.419. ", "F.410. ", "F.411. ", "F.412. ", "F.413. ", "F.414. ", "F.415. ", "F.416. ", "F.417. ", "F.418. ", "F.419. "], "single-stranded_segments": [], "strands": [{"interacts_with_protein": true, "5p_end": "E.409. ", "chemical_modifications": {"5_methylated_cytosine": false, "non-standard_nucleotides": false}, "strand_id": "E1", "sequence": "GAACCGGTTC", "ids": ["E.400. ", "E.401. ", "E.402. ", "E.403. ", "E.404. ", "E.405. ", "E.406. ", "E.407. ", "E.408. ", "E.409. "], "chain_id": "E", "length": 10, "GC_content": 0.6, "3p_end": "E.400. "}, {"interacts_with_protein": true, "5p_end": "C.409. ", "chemical_modifications": {"5_methylated_cytosine": false, "non-standard_nucleotides": false}, "strand_id": "C1", "sequence": "GAACCGGTTC", "ids": ["C.400. ", "C.401. ", "C.402. ", "C.403. ", "C.404. ", "C.405. ", "C.406. ", "C.407. ", "C.408. ", "C.409. "], "chain_id": "C", "length": 10, "GC_content": 0.6, "3p_end": "C.400. "}, {"interacts_with_protein": true, "5p_end": "D.419. ", "chemical_modifications": {"5_methylated_cytosine": false, "non-standard_nucleotides": false}, "strand_id": "D1", "sequence": "GAACCGGTTC", "ids": ["D.410. ", "D.411. ", "D.412. ", "D.413. ", "D.414. ", "D.415. ", "D.416. ", "D.417. ", "D.418. ", "D.419. "], "chain_id": "D", "length": 10, "GC_content": 0.6, "3p_end": "D.410. "}, {"interacts_with_protein": true, "5p_end": "F.419. ", "chemical_modifications": {"5_methylated_cytosine": false, "non-standard_nucleotides": false}, "strand_id": "F1", "sequence": "GAACCGGTTC", "ids": ["F.410. ", "F.411. ", "F.412. ", "F.413. ", "F.414. ", "F.415. ", "F.416. ", "F.417. ", "F.418. ", "F.419. "], "chain_id": "F", "length": 10, "GC_content": 0.6, "3p_end": "F.410. "}], "id": "C1@D1@E1@F1", "num_helical_segments": 1}], "ignored_entities": [], "stacks": [{"id2": "E.401. ", "id1": "E.400. ", "mindist": 3.433, "name2": "E", "name1": "E", "id": "E.400. @E.401. "}, {"id2": "E.402. ", "id1": "E.401. ", "mindist": 3.185, "name2": "E", "name1": "E", "id": "E.401. @E.402. "}, {"id2": "E.403. ", "id1": "E.402. ", "mindist": 3.195, "name2": "E", "name1": "E", "id": "E.402. @E.403. "}, {"id2": "E.404. ", "id1": "E.403. ", "mindist": 4.376, "name2": "E", "name1": "E", "id": "E.403. @E.404. "}, {"id2": "E.405. ", "id1": "E.404. ", "mindist": 3.451, "name2": "E", "name1": "E", "id": "E.404. @E.405. "}, {"id2": "E.406. ", "id1": "E.405. ", "mindist": 3.078, "name2": "E", "name1": "E", "id": "E.405. @E.406. "}, {"id2": "E.407. ", "id1": "E.406. ", "mindist": 3.401, "name2": "E", "name1": "E", "id": "E.406. @E.407. "}, {"id2": "E.408. ", "id1": "E.407. ", "mindist": 3.178, "name2": "E", "name1": "E", "id": "E.407. @E.408. "}, {"id2": "E.409. ", "id1": "E.408. ", "mindist": 3.403, "name2": "E", "name1": "E", "id": "E.408. @E.409. "}, {"id2": "C.400. ", "id1": "E.409. ", "mindist": 3.659, "name2": "C", "name1": "E", "id": "C.400. @E.409. "}, {"id2": "F.411. ", "id1": "F.410. ", "mindist": 3.412, "name2": "F", "name1": "F", "id": "F.410. @F.411. "}, {"id2": "D.419. ", "id1": "F.410. ", "mindist": 3.768, "name2": "D", "name1": "F", "id": "D.419. @F.410. "}, {"id2": "F.412. ", "id1": "F.411. ", "mindist": 3.425, "name2": "F", "name1": "F", "id": "F.411. @F.412. "}, {"id2": "F.413. ", "id1": "F.412. ", "mindist": 3.459, "name2": "F", "name1": "F", "id": "F.412. @F.413. "}, {"id2": "F.414. ", "id1": "F.413. ", "mindist": 3.505, "name2": "F", "name1": "F", "id": "F.413. @F.414. "}, {"id2": "F.415. ", "id1": "F.414. ", "mindist": 3.199, "name2": "F", "name1": "F", "id": "F.414. @F.415. "}, {"id2": "F.416. ", "id1": "F.415. ", "mindist": 3.599, "name2": "F", "name1": "F", "id": "F.415. @F.416. "}, {"id2": "F.417. ", "id1": "F.416. ", "mindist": 3.468, "name2": "F", "name1": "F", "id": "F.416. @F.417. "}, {"id2": "F.418. ", "id1": "F.417. ", "mindist": 3.233, "name2": "F", "name1": "F", "id": "F.417. @F.418. "}, {"id2": "F.419. ", "id1": "F.418. ", "mindist": 3.136, "name2": "F", "name1": "F", "id": "F.418. @F.419. "}, {"id2": "C.401. ", "id1": "C.400. ", "mindist": 3.433, "name2": "C", "name1": "C", "id": "C.400. @C.401. "}, {"id2": "C.402. ", "id1": "C.401. ", "mindist": 3.185, "name2": "C", "name1": "C", "id": "C.401. @C.402. "}, {"id2": "C.403. ", "id1": "C.402. ", "mindist": 3.195, "name2": "C", "name1": "C", "id": "C.402. @C.403. "}, {"id2": "C.404. ", "id1": "C.403. ", "mindist": 4.376, "name2": "C", "name1": "C", "id": "C.403. @C.404. "}, {"id2": "C.405. ", "id1": "C.404. ", "mindist": 3.451, "name2": "C", "name1": "C", "id": "C.404. @C.405. "}, {"id2": "C.406. ", "id1": "C.405. ", "mindist": 3.078, "name2": "C", "name1": "C", "id": "C.405. @C.406. "}, {"id2": "C.407. ", "id1": "C.406. ", "mindist": 3.401, "name2": "C", "name1": "C", "id": "C.406. @C.407. "}, {"id2": "C.408. ", "id1": "C.407. ", "mindist": 3.178, "name2": "C", "name1": "C", "id": "C.407. @C.408. "}, {"id2": "C.409. ", "id1": "C.408. ", "mindist": 3.403, "name2": "C", "name1": "C", "id": "C.408. @C.409. "}, {"id2": "D.411. ", "id1": "D.410. ", "mindist": 3.412, "name2": "D", "name1": "D", "id": "D.410. @D.411. "}, {"id2": "D.412. ", "id1": "D.411. ", "mindist": 3.425, "name2": "D", "name1": "D", "id": "D.411. @D.412. "}, {"id2": "D.413. ", "id1": "D.412. ", "mindist": 3.459, "name2": "D", "name1": "D", "id": "D.412. @D.413. "}, {"id2": "D.414. ", "id1": "D.413. ", "mindist": 3.505, "name2": "D", "name1": "D", "id": "D.413. @D.414. "}, {"id2": "D.415. ", "id1": "D.414. ", "mindist": 3.199, "name2": "D", "name1": "D", "id": "D.414. @D.415. "}, {"id2": "D.416. ", "id1": "D.415. ", "mindist": 3.599, "name2": "D", "name1": "D", "id": "D.415. @D.416. "}, {"id2": "D.417. ", "id1": "D.416. ", "mindist": 3.468, "name2": "D", "name1": "D", "id": "D.416. @D.417. "}, {"id2": "D.418. ", "id1": "D.417. ", "mindist": 3.233, "name2": "D", "name1": "D", "id": "D.417. @D.418. "}, {"id2": "D.419. ", "id1": "D.418. ", "mindist": 3.136, "name2": "D", "name1": "D", "id": "D.418. @D.419. "}]}], "nucleotides": [{"ins_code": "400", "origin": [[-21.981, -31.921, 24.279]], "number": 400, "graph_coordinates": [{"radial": {"y": 1.0, "x": -0.05263157893856256}, "rnascape": {"y": 1.0, "x": -0.07040818025452707}, "circular": {"y": 0.0, "x": 7.002817496043395}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 53.517, "sr": 71.797, "pp": 96.341, "total": 266.347, "sg": 44.693}], "id": "E.400. ", "name": "DG"}, {"ins_code": "401", "origin": [[-21.217, -32.397, 20.557]], "number": 401, "graph_coordinates": [{"radial": {"y": 0.8947368421228749, "x": -0.05263157893856256}, "rnascape": {"y": 0.8947946388321897, "x": -0.07115363150076524}, "circular": {"y": 0.9966048394067474, "x": 6.931538911162696}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE", "name_short": "A", "modified": false, "fasa": [{"wg": 25.03, "sr": 72.965, "pp": 68.648, "total": 175.476, "sg": 8.833}], "id": "E.401. ", "name": "DA"}, {"ins_code": "402", "origin": [[-21.663, -32.438, 17.424]], "number": 402, "graph_coordinates": [{"radial": {"y": 0.7894736842457497, "x": -0.05263157893856256}, "rnascape": {"y": 0.7895892776643796, "x": -0.07189908274700343}, "circular": {"y": 1.972921678254204, "x": 6.719154182958306}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE", "name_short": "A", "modified": false, "fasa": [{"wg": 27.251, "sr": 67.267, "pp": 76.437, "total": 174.906, "sg": 3.951}], "id": "E.402. ", "name": "DA"}, {"ins_code": "403", "origin": [[-22.067, -31.901, 14.185]], "number": 403, "graph_coordinates": [{"radial": {"y": 0.6842105263686247, "x": -0.05263157893856256}, "rnascape": {"y": 0.6843839164965694, "x": -0.07264453399324161}, "circular": {"y": 2.9090755211687043, "x": 6.369986852029486}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 27.107, "sr": 61.91, "pp": 76.855, "total": 170.467, "sg": 4.595}], "id": "E.403. ", "name": "DC"}, {"ins_code": "404", "origin": [[-22.105, -33.052, 9.849]], "number": 404, "graph_coordinates": [{"radial": {"y": 0.5789473684914995, "x": -0.05263157893856256}, "rnascape": {"y": 0.5791785553287592, "x": -0.0733899852394798}, "circular": {"y": 3.786008975553262, "x": 5.891144958318512}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 35.356, "sr": 50.05, "pp": 73.838, "total": 160.649, "sg": 1.405}], "id": "E.404. ", "name": "DC"}, {"ins_code": "405", "origin": [[-23.112, -33.222, 6.615]], "number": 405, "graph_coordinates": [{"radial": {"y": 0.4736842106143744, "x": -0.05263157893856256}, "rnascape": {"y": 0.47397319416094885, "x": -0.07413543648571798}, "circular": {"y": 4.585870205143862, "x": 5.2923763419153484}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 30.046, "sr": 65.371, "pp": 71.787, "total": 179.998, "sg": 12.792}], "id": "E.405. ", "name": "DG"}, {"ins_code": "406", "origin": [[-23.755, -32.704, 3.682]], "number": 406, "graph_coordinates": [{"radial": {"y": 0.36842104939102355, "x": -0.05263157893856256}, "rnascape": {"y": 0.3687678329931387, "x": -0.07488088773195616}, "circular": {"y": 5.2923763419153484, "x": 4.585870205143862}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 15.17, "sr": 76.651, "pp": 68.586, "total": 171.526, "sg": 11.119}], "id": "E.406. ", "name": "DG"}, {"ins_code": "407", "origin": [[-23.192, -33.343, -0.096]], "number": 407, "graph_coordinates": [{"radial": {"y": 0.2631578948601241, "x": -0.05263157893856256}, "rnascape": {"y": 0.26356247182532855, "x": -0.07562633897819433}, "circular": {"y": 5.891144958318511, "x": 3.786008975553263}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "THYMIDINE-5'-MONOPHOSPHATE", "name_short": "T", "modified": false, "fasa": [{"wg": 39.474, "sr": 56.396, "pp": 77.087, "total": 177.15, "sg": 4.192}], "id": "E.407. ", "name": "DT"}, {"ins_code": "408", "origin": [[-23.466, -33.439, -2.781]], "number": 408, "graph_coordinates": [{"radial": {"y": 0.15789473698299897, "x": -0.05263157893856256}, "rnascape": {"y": 0.15835711065751834, "x": -0.07637179022443251}, "circular": {"y": 6.369986852029485, "x": 2.9090755211687047}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "THYMIDINE-5'-MONOPHOSPHATE", "name_short": "T", "modified": false, "fasa": [{"wg": 47.827, "sr": 60.054, "pp": 69.726, "total": 184.533, "sg": 6.926}], "id": "E.408. ", "name": "DT"}, {"ins_code": "409", "origin": [[-22.811, -34.028, -6.499]], "number": 409, "graph_coordinates": [{"radial": {"y": 0.052631579105873835, "x": -0.05263157893856256}, "rnascape": {"y": 0.053151749489708064, "x": -0.0771172414706707}, "circular": {"y": 6.719154182958306, "x": 1.9729216782542047}}], "chain": "E", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 14.747, "sr": 69.307, "pp": 77.754, "total": 176.353, "sg": 14.544}], "id": "E.409. ", "name": "DC"}, {"ins_code": "410", "origin": [[-23.108, -33.469, -6.558]], "number": 410, "graph_coordinates": [{"radial": {"y": 0.052631579105873835, "x": 0.05263157893856256}, "rnascape": {"y": 0.05205361167810202, "x": 0.07786269271690886}, "circular": {"y": -7.002817496043395, "x": -1.2863967047313938e-15}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 28.47, "sr": 77.708, "pp": 67.878, "total": 193.816, "sg": 19.759}], "id": "F.410. ", "name": "DG"}, {"ins_code": "411", "origin": [[-23.997, -33.564, -2.91]], "number": 411, "graph_coordinates": [{"radial": {"y": 0.15789473698299897, "x": 0.05263157893856256}, "rnascape": {"y": 0.15725897284591228, "x": 0.07860814396314705}, "circular": {"y": -6.931538911162697, "x": 0.9966048394067455}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE", "name_short": "A", "modified": false, "fasa": [{"wg": 29.984, "sr": 63.03, "pp": 69.27, "total": 165.863, "sg": 3.578}], "id": "F.411. ", "name": "DA"}, {"ins_code": "412", "origin": [[-23.446, -33.677, 0.42]], "number": 412, "graph_coordinates": [{"radial": {"y": 0.2631578948601241, "x": 0.05263157893856256}, "rnascape": {"y": 0.26246433401372254, "x": 0.07935359520938523}, "circular": {"y": -6.719154182958307, "x": 1.9729216782542016}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE", "name_short": "A", "modified": false, "fasa": [{"wg": 33.279, "sr": 69.056, "pp": 76.455, "total": 183.172, "sg": 4.383}], "id": "F.412. ", "name": "DA"}, {"ins_code": "413", "origin": [[-23.551, -33.084, 4.247]], "number": 413, "graph_coordinates": [{"radial": {"y": 0.36842104939102355, "x": 0.05263157893856256}, "rnascape": {"y": 0.3676696951815327, "x": 0.08009904645562342}, "circular": {"y": -6.369986852029487, "x": 2.909075521168702}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 30.174, "sr": 56.792, "pp": 77.712, "total": 167.616, "sg": 2.938}], "id": "F.413. ", "name": "DC"}, {"ins_code": "414", "origin": [[-23.006, -33.636, 7.6]], "number": 414, "graph_coordinates": [{"radial": {"y": 0.4736842106143744, "x": 0.05263157893856256}, "rnascape": {"y": 0.47287505634934285, "x": 0.0808444977018616}, "circular": {"y": -5.891144958318514, "x": 3.786008975553259}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 33.742, "sr": 50.741, "pp": 77.445, "total": 163.319, "sg": 1.391}], "id": "F.414. ", "name": "DC"}, {"ins_code": "415", "origin": [[-22.5, -32.781, 10.431]], "number": 415, "graph_coordinates": [{"radial": {"y": 0.5789473684914995, "x": 0.05263157893856256}, "rnascape": {"y": 0.5780804175171531, "x": 0.08158994894809977}, "circular": {"y": -5.292376341915348, "x": 4.585870205143863}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 33.779, "sr": 66.464, "pp": 72.82, "total": 189.341, "sg": 16.278}], "id": "F.415. ", "name": "DG"}, {"ins_code": "416", "origin": [[-22.693, -31.898, 14.295]], "number": 416, "graph_coordinates": [{"radial": {"y": 0.6842105263686247, "x": 0.05263157893856256}, "rnascape": {"y": 0.6832857786849633, "x": 0.08233540019433797}, "circular": {"y": -4.58587020514386, "x": 5.292376341915349}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 17.281, "sr": 76.416, "pp": 68.29, "total": 177.939, "sg": 15.952}], "id": "F.416. ", "name": "DG"}, {"ins_code": "417", "origin": [[-21.734, -32.689, 17.67]], "number": 417, "graph_coordinates": [{"radial": {"y": 0.7894736842457497, "x": 0.05263157893856256}, "rnascape": {"y": 0.7884911398527735, "x": 0.08308085144057613}, "circular": {"y": -3.786008975553261, "x": 5.891144958318512}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "THYMIDINE-5'-MONOPHOSPHATE", "name_short": "T", "modified": false, "fasa": [{"wg": 45.4, "sr": 44.333, "pp": 81.133, "total": 172.019, "sg": 1.152}], "id": "F.417. ", "name": "DT"}, {"ins_code": "418", "origin": [[-21.812, -32.867, 20.559]], "number": 418, "graph_coordinates": [{"radial": {"y": 0.8947368421228749, "x": 0.05263157893856256}, "rnascape": {"y": 0.8936965010205836, "x": 0.08382630268681432}, "circular": {"y": -2.9090755211687047, "x": 6.369986852029485}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "THYMIDINE-5'-MONOPHOSPHATE", "name_short": "T", "modified": false, "fasa": [{"wg": 32.424, "sr": 60.487, "pp": 74.414, "total": 177.03, "sg": 9.706}], "id": "F.418. ", "name": "DT"}, {"ins_code": "419", "origin": [[-21.976, -31.807, 24.036]], "number": 419, "graph_coordinates": [{"radial": {"y": 1.0, "x": 0.05263157893856256}, "rnascape": {"y": 0.9989018621883939, "x": 0.0845717539330525}, "circular": {"y": -1.9729216782542047, "x": 6.719154182958306}}], "chain": "F", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 52.48, "sr": 127.475, "pp": 78.3, "total": 277.162, "sg": 18.906}], "id": "F.419. ", "name": "DC"}, {"ins_code": "400", "origin": [[-21.981, -31.921, -10.069]], "number": 400, "graph_coordinates": [{"radial": {"y": -0.05263157877125129, "x": -0.05263157893856256}, "rnascape": {"y": -0.0520536116781022, "x": -0.07786269271690886}, "circular": {"y": 7.002817496043395, "x": 4.2879890157713134e-16}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 29.317, "sr": 57.224, "pp": 67.733, "total": 168.202, "sg": 13.928}], "id": "C.400. ", "name": "DG"}, {"ins_code": "401", "origin": [[-21.217, -32.397, -13.791]], "number": 401, "graph_coordinates": [{"radial": {"y": -0.15789473664837642, "x": -0.05263157893856256}, "rnascape": {"y": -0.15725897284591223, "x": -0.07860814396314705}, "circular": {"y": 6.931538911162697, "x": -0.9966048394067464}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE", "name_short": "A", "modified": false, "fasa": [{"wg": 25.03, "sr": 72.965, "pp": 68.648, "total": 175.476, "sg": 8.833}], "id": "C.401. ", "name": "DA"}, {"ins_code": "402", "origin": [[-21.663, -32.438, -16.924]], "number": 402, "graph_coordinates": [{"radial": {"y": -0.26315789452550153, "x": -0.05263157893856256}, "rnascape": {"y": -0.26246433401372254, "x": -0.07935359520938523}, "circular": {"y": 6.719154182958306, "x": -1.972921678254204}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE", "name_short": "A", "modified": false, "fasa": [{"wg": 27.251, "sr": 67.267, "pp": 76.437, "total": 174.906, "sg": 3.951}], "id": "C.402. ", "name": "DA"}, {"ins_code": "403", "origin": [[-22.067, -31.901, -20.163]], "number": 403, "graph_coordinates": [{"radial": {"y": -0.3684210524026267, "x": -0.05263157893856256}, "rnascape": {"y": -0.3676696951815328, "x": -0.08009904645562341}, "circular": {"y": 6.369986852029486, "x": -2.909075521168704}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 27.107, "sr": 61.91, "pp": 76.855, "total": 170.467, "sg": 4.595}], "id": "C.403. ", "name": "DC"}, {"ins_code": "404", "origin": [[-22.105, -33.052, -24.499]], "number": 404, "graph_coordinates": [{"radial": {"y": -0.4736842102797517, "x": -0.05263157893856256}, "rnascape": {"y": -0.4728750563493428, "x": -0.0808444977018616}, "circular": {"y": 5.891144958318511, "x": -3.786008975553263}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 35.356, "sr": 50.05, "pp": 73.838, "total": 160.649, "sg": 1.405}], "id": "C.404. ", "name": "DC"}, {"ins_code": "405", "origin": [[-23.112, -33.222, -27.733]], "number": 405, "graph_coordinates": [{"radial": {"y": -0.5789473681568769, "x": -0.05263157893856256}, "rnascape": {"y": -0.5780804175171531, "x": -0.08158994894809977}, "circular": {"y": 5.2923763419153484, "x": -4.585870205143861}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 30.046, "sr": 65.371, "pp": 71.787, "total": 179.998, "sg": 12.792}], "id": "C.405. ", "name": "DG"}, {"ins_code": "406", "origin": [[-23.755, -32.704, -30.666]], "number": 406, "graph_coordinates": [{"radial": {"y": -0.684210526034002, "x": -0.05263157893856256}, "rnascape": {"y": -0.6832857786849633, "x": -0.08233540019433794}, "circular": {"y": 4.585870205143862, "x": -5.292376341915348}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 15.17, "sr": 76.651, "pp": 68.586, "total": 171.526, "sg": 11.119}], "id": "C.406. ", "name": "DG"}, {"ins_code": "407", "origin": [[-23.192, -33.343, -34.444]], "number": 407, "graph_coordinates": [{"radial": {"y": -0.7894736839111272, "x": -0.05263157893856256}, "rnascape": {"y": -0.7884911398527734, "x": -0.08308085144057613}, "circular": {"y": 3.7860089755532633, "x": -5.891144958318511}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "THYMIDINE-5'-MONOPHOSPHATE", "name_short": "T", "modified": false, "fasa": [{"wg": 39.474, "sr": 56.396, "pp": 77.087, "total": 177.15, "sg": 4.192}], "id": "C.407. ", "name": "DT"}, {"ins_code": "408", "origin": [[-23.466, -33.439, -37.129]], "number": 408, "graph_coordinates": [{"radial": {"y": -0.8947368417882522, "x": -0.05263157893856256}, "rnascape": {"y": -0.8936965010205838, "x": -0.0838263026868143}, "circular": {"y": 2.909075521168704, "x": -6.369986852029486}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "THYMIDINE-5'-MONOPHOSPHATE", "name_short": "T", "modified": false, "fasa": [{"wg": 47.827, "sr": 60.054, "pp": 69.726, "total": 184.533, "sg": 6.926}], "id": "C.408. ", "name": "DT"}, {"ins_code": "409", "origin": [[-22.811, -34.028, -40.847]], "number": 409, "graph_coordinates": [{"radial": {"y": -0.9999999996653773, "x": -0.05263157893856256}, "rnascape": {"y": -0.9989018621883939, "x": -0.0845717539330525}, "circular": {"y": 1.972921678254204, "x": -6.719154182958306}}], "chain": "C", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 45.865, "sr": 129.253, "pp": 77.754, "total": 279.798, "sg": 26.777}], "id": "C.409. ", "name": "DC"}, {"ins_code": "410", "origin": [[-23.108, -33.469, -40.906]], "number": 410, "graph_coordinates": [{"radial": {"y": -0.9999999996653773, "x": 0.05263157893856256}, "rnascape": {"y": -1.0, "x": 0.07040818025452705}, "circular": {"y": 8.575978031542627e-16, "x": -7.002817496043395}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 66.917, "sr": 78.342, "pp": 102.277, "total": 287.525, "sg": 39.989}], "id": "D.410. ", "name": "DG"}, {"ins_code": "411", "origin": [[-23.997, -33.564, -37.258]], "number": 411, "graph_coordinates": [{"radial": {"y": -0.8947368417882522, "x": 0.05263157893856256}, "rnascape": {"y": -0.8947946388321899, "x": 0.07115363150076523}, "circular": {"y": -0.9966048394067458, "x": -6.931538911162697}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE", "name_short": "A", "modified": false, "fasa": [{"wg": 29.984, "sr": 63.03, "pp": 69.27, "total": 165.863, "sg": 3.578}], "id": "D.411. ", "name": "DA"}, {"ins_code": "412", "origin": [[-23.446, -33.677, -33.928]], "number": 412, "graph_coordinates": [{"radial": {"y": -0.7894736839111272, "x": 0.05263157893856256}, "rnascape": {"y": -0.7895892776643795, "x": 0.07189908274700343}, "circular": {"y": -1.972921678254202, "x": -6.719154182958307}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE", "name_short": "A", "modified": false, "fasa": [{"wg": 33.279, "sr": 69.056, "pp": 76.455, "total": 183.172, "sg": 4.383}], "id": "D.412. ", "name": "DA"}, {"ins_code": "413", "origin": [[-23.551, -33.084, -30.101]], "number": 413, "graph_coordinates": [{"radial": {"y": -0.684210526034002, "x": 0.05263157893856256}, "rnascape": {"y": -0.6843839164965694, "x": 0.07264453399324161}, "circular": {"y": -2.909075521168705, "x": -6.369986852029485}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 30.174, "sr": 56.792, "pp": 77.712, "total": 167.616, "sg": 2.938}], "id": "D.413. ", "name": "DC"}, {"ins_code": "414", "origin": [[-23.006, -33.636, -26.748]], "number": 414, "graph_coordinates": [{"radial": {"y": -0.5789473681568769, "x": 0.05263157893856256}, "rnascape": {"y": -0.5791785553287592, "x": 0.0733899852394798}, "circular": {"y": -3.786008975553262, "x": -5.891144958318512}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 33.742, "sr": 50.741, "pp": 77.445, "total": 163.319, "sg": 1.391}], "id": "D.414. ", "name": "DC"}, {"ins_code": "415", "origin": [[-22.5, -32.781, -23.917]], "number": 415, "graph_coordinates": [{"radial": {"y": -0.4736842102797517, "x": 0.05263157893856256}, "rnascape": {"y": -0.4739731941609489, "x": 0.07413543648571798}, "circular": {"y": -4.585870205143861, "x": -5.292376341915349}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 33.779, "sr": 66.464, "pp": 72.82, "total": 189.341, "sg": 16.278}], "id": "D.415. ", "name": "DG"}, {"ins_code": "416", "origin": [[-22.693, -31.898, -20.053]], "number": 416, "graph_coordinates": [{"radial": {"y": -0.3684210524026267, "x": 0.05263157893856256}, "rnascape": {"y": -0.3687678329931388, "x": 0.07488088773195614}, "circular": {"y": -5.292376341915348, "x": -4.585870205143862}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE", "name_short": "G", "modified": false, "fasa": [{"wg": 17.281, "sr": 76.416, "pp": 68.29, "total": 177.939, "sg": 15.952}], "id": "D.416. ", "name": "DG"}, {"ins_code": "417", "origin": [[-21.734, -32.689, -16.678]], "number": 417, "graph_coordinates": [{"radial": {"y": -0.26315789452550153, "x": 0.05263157893856256}, "rnascape": {"y": -0.26356247182532855, "x": 0.07562633897819433}, "circular": {"y": -5.891144958318512, "x": -3.786008975553261}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "THYMIDINE-5'-MONOPHOSPHATE", "name_short": "T", "modified": false, "fasa": [{"wg": 45.4, "sr": 44.333, "pp": 81.133, "total": 172.019, "sg": 1.152}], "id": "D.417. ", "name": "DT"}, {"ins_code": "418", "origin": [[-21.812, -32.867, -13.789]], "number": 418, "graph_coordinates": [{"radial": {"y": -0.15789473664837642, "x": 0.05263157893856256}, "rnascape": {"y": -0.15835711065751829, "x": 0.07637179022443251}, "circular": {"y": -6.369986852029486, "x": -2.9090755211687043}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "THYMIDINE-5'-MONOPHOSPHATE", "name_short": "T", "modified": false, "fasa": [{"wg": 32.424, "sr": 60.487, "pp": 74.414, "total": 177.03, "sg": 9.706}], "id": "D.418. ", "name": "DT"}, {"ins_code": "419", "origin": [[-21.976, -31.807, -10.312]], "number": 419, "graph_coordinates": [{"radial": {"y": -0.05263157877125129, "x": 0.05263157893856256}, "rnascape": {"y": -0.053151749489708244, "x": 0.07711724147067067}, "circular": {"y": -6.719154182958306, "x": -1.9729216782542045}}], "chain": "D", "phosphate_present": true, "secondary_structure": ["helical"], "glycosidic_conformation": ["anti"], "chemical_name": "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE", "name_short": "C", "modified": false, "fasa": [{"wg": 35.388, "sr": 54.411, "pp": 78.3, "total": 174.976, "sg": 6.877}], "id": "D.419. ", "name": "DC"}], "num_nucleotides": 40, "chains": [{"nucleotide_ids": ["E.400. ", "E.401. ", "E.402. ", "E.403. ", "E.404. ", "E.405. ", "E.406. ", "E.407. ", "E.408. ", "E.409. "], "sequence": "GAACCGGTTC", "id": "E", "num_nucleotides": 10, "au_chain_id": "E"}, {"nucleotide_ids": ["F.410. ", "F.411. ", "F.412. ", "F.413. ", "F.414. ", "F.415. ", "F.416. ", "F.417. ", "F.418. ", "F.419. "], "sequence": "GAACCGGTTC", "id": "F", "num_nucleotides": 10, "au_chain_id": "F"}, {"nucleotide_ids": ["C.400. ", "C.401. ", "C.402. ", "C.403. ", "C.404. ", "C.405. ", "C.406. ", "C.407. ", "C.408. ", "C.409. "], "sequence": "GAACCGGTTC", "id": "C", "num_nucleotides": 10, "au_chain_id": "E"}, {"nucleotide_ids": ["D.410. ", "D.411. ", "D.412. ", "D.413. ", "D.414. ", "D.415. ", "D.416. ", "D.417. ", "D.418. ", "D.419. "], "sequence": "GAACCGGTTC", "id": "D", "num_nucleotides": 10, "au_chain_id": "F"}], "num_chains": 4}, "interfaces": {"models": [[{"dna_entity_id": "C1@D1@E1@F1", "nucleotide-sse_interactions": [{"nuc_number": "417", "sse_basa": {"sc": 0.099, "total": 0.099, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.196, "sr": 0.0, "pp": 0.0, "total": 0.196, "sg": 0.0}, "sse_id": "HG3", "nuc_name": "DT", "nuc_id": "D.417. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.295, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 0.295, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "416", "sse_basa": {"sc": 12.992, "total": 13.105, "mc": 0.112}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 9.177, "pp": 7.844, "total": 17.021, "sg": 0.0}, "sse_id": "A.261. ", "nuc_name": "DG", "nuc_id": "F.416. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.297, "mc": 0.0}, "pp": {"sc": 8.611, "mc": 0.248}, "total": 30.125, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "415", "sse_basa": {"sc": 33.403, "total": 33.403, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 4.527, "pp": 22.143, "total": 26.67, "sg": 0.0}, "sse_id": "SA11", "nuc_name": "DG", "nuc_id": "F.415. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 7.062, "mc": 0.0}, "pp": {"sc": 40.67, "mc": 0.0}, "total": 60.073, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "total": 7, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "415", "sse_basa": {"sc": 9.905, "total": 9.905, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 7.53, "pp": 0.0, "total": 7.53, "sg": 0.0}, "sse_id": "G.261. ", "nuc_name": "DG", "nuc_id": "D.415. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.196, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 17.435, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "416", "sse_basa": {"sc": 1.204, "total": 1.204, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 1.952, "total": 1.952, "sg": 0.0}, "sse_id": "A.295. ", "nuc_name": "DG", "nuc_id": "F.416. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 3.114, "mc": 0.0}, "total": 3.157, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.mc", "pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "416", "sse_basa": {"sc": 15.619, "total": 17.432, "mc": 1.814}, "sse_chain": "A", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.334, "sr": 11.794, "pp": 0.275, "total": 12.403, "sg": 0.0}, "sse_id": "A.296. ", "nuc_name": "DG", "nuc_id": "F.416. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.352, "mc": 0.0}, "sr": {"sc": 15.708, "mc": 0.0}, "pp": {"sc": 0.297, "mc": 0.479}, "total": 29.836, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "417", "sse_basa": {"sc": 6.238, "total": 8.124, "mc": 1.885}, "sse_chain": "A", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 7.247, "sr": 0.0, "pp": 3.111, "total": 10.358, "sg": 0.0}, "sse_id": "A.296. ", "nuc_name": "DT", "nuc_id": "F.417. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 10.851, "mc": 3.108}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 5.746, "mc": 0.0}, "total": 18.482, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc", "wg.mc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"]}, {"nuc_number": "416", "sse_basa": {"sc": 15.619, "total": 17.432, "mc": 1.814}, "sse_chain": "G", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.334, "sr": 11.794, "pp": 0.275, "total": 12.403, "sg": 0.0}, "sse_id": "G.296. ", "nuc_name": "DG", "nuc_id": "D.416. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.352, "mc": 0.0}, "sr": {"sc": 15.708, "mc": 0.0}, "pp": {"sc": 0.297, "mc": 0.479}, "total": 29.836, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "417", "sse_basa": {"sc": 6.238, "total": 8.124, "mc": 1.885}, "sse_chain": "G", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 7.247, "sr": 0.0, "pp": 3.111, "total": 10.358, "sg": 0.0}, "sse_id": "G.296. ", "nuc_name": "DT", "nuc_id": "D.417. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 10.851, "mc": 3.108}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 5.746, "mc": 0.0}, "total": 18.482, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc", "wg.mc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"]}, {"nuc_number": "407", "sse_basa": {"sc": 31.608, "total": 31.608, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 32.607, "pp": 2.093, "total": 34.7, "sg": 0.0}, "sse_id": "A.268. ", "nuc_name": "DT", "nuc_id": "E.407. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 57.199, "mc": 0.0}, "pp": {"sc": 3.913, "mc": 0.0}, "total": 66.307, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "402", "sse_basa": {"sc": 3.465, "total": 3.465, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 11.108, "sr": 0.0, "pp": 0.0, "total": 11.108, "sg": 0.0}, "sse_id": "HG3", "nuc_name": "DA", "nuc_id": "C.402. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 14.169, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 14.573, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "402", "sse_basa": {"sc": 3.465, "total": 3.465, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 11.108, "sr": 0.0, "pp": 0.0, "total": 11.108, "sg": 0.0}, "sse_id": "HA3", "nuc_name": "DA", "nuc_id": "E.402. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 14.169, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 14.573, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "409", "sse_basa": {"sc": 30.568, "total": 30.568, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 3.6, "pp": 24.85, "total": 28.45, "sg": 0.0}, "sse_id": "G.139. ", "nuc_name": "DC", "nuc_id": "E.409. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 5.411, "mc": 0.0}, "pp": {"sc": 42.752, "mc": 0.0}, "total": 59.018, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 3, "mc": 0}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "416", "sse_basa": {"sc": 9.268, "total": 9.268, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 8.781, "sr": 0.0, "pp": 0.55, "total": 9.331, "sg": 0.0}, "sse_id": "HG3", "nuc_name": "DG", "nuc_id": "D.416. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 9.588, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 1.026, "mc": 0.0}, "total": 18.599, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 4, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"]}, {"nuc_number": "407", "sse_basa": {"sc": 31.608, "total": 31.608, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 32.607, "pp": 2.093, "total": 34.7, "sg": 0.0}, "sse_id": "G.268. ", "nuc_name": "DT", "nuc_id": "C.407. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 57.199, "mc": 0.0}, "pp": {"sc": 3.913, "mc": 0.0}, "total": 66.307, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "415", "sse_basa": {"sc": 33.403, "total": 33.403, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 4.527, "pp": 22.143, "total": 26.67, "sg": 0.0}, "sse_id": "SG11", "nuc_name": "DG", "nuc_id": "D.415. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 7.062, "mc": 0.0}, "pp": {"sc": 40.67, "mc": 0.0}, "total": 60.073, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "total": 7, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "415", "sse_basa": {"sc": 9.905, "total": 9.905, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 7.53, "pp": 0.0, "total": 7.53, "sg": 0.0}, "sse_id": "A.261. ", "nuc_name": "DG", "nuc_id": "F.415. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.196, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 17.435, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "416", "sse_basa": {"sc": 0.786, "total": 1.018, "mc": 0.232}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.077, "total": 0.077, "sg": 0.0}, "sse_id": "G.297. ", "nuc_name": "DG", "nuc_id": "D.416. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.761, "mc": 0.232}, "total": 1.095, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "416", "sse_basa": {"sc": 0.786, "total": 1.018, "mc": 0.232}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.077, "total": 0.077, "sg": 0.0}, "sse_id": "A.297. ", "nuc_name": "DG", "nuc_id": "F.416. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.761, "mc": 0.232}, "total": 1.095, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "417", "sse_basa": {"sc": 11.021, "total": 11.021, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 6.729, "sr": 0.0, "pp": 0.0, "total": 6.729, "sg": 0.0}, "sse_id": "A.297. ", "nuc_name": "DT", "nuc_id": "F.417. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 17.75, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 17.75, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "416", "sse_basa": {"sc": 9.268, "total": 9.268, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 8.781, "sr": 0.0, "pp": 0.55, "total": 9.331, "sg": 0.0}, "sse_id": "HA3", "nuc_name": "DG", "nuc_id": "F.416. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 9.588, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 1.026, "mc": 0.0}, "total": 18.599, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 4, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"]}, {"nuc_number": "417", "sse_basa": {"sc": 11.021, "total": 11.021, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 6.729, "sr": 0.0, "pp": 0.0, "total": 6.729, "sg": 0.0}, "sse_id": "G.297. ", "nuc_name": "DT", "nuc_id": "D.417. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 17.75, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 17.75, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "400", "sse_basa": {"sc": 33.817, "total": 37.201, "mc": 3.384}, "sse_chain": "G", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 1.967, "sr": 14.14, "pp": 19.545, "total": 35.653, "sg": 0.0}, "sse_id": "G.138. ", "nuc_name": "DG", "nuc_id": "C.400. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 3.084, "mc": 0.0}, "sr": {"sc": 20.577, "mc": 0.0}, "pp": {"sc": 28.564, "mc": 4.621}, "total": 72.854, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "416", "sse_basa": {"sc": 1.204, "total": 1.204, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 1.952, "total": 1.952, "sg": 0.0}, "sse_id": "G.295. ", "nuc_name": "DG", "nuc_id": "D.416. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 3.114, "mc": 0.0}, "total": 3.157, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.mc", "pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "416", "sse_basa": {"sc": 12.992, "total": 13.105, "mc": 0.112}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 9.177, "pp": 7.844, "total": 17.021, "sg": 0.0}, "sse_id": "G.261. ", "nuc_name": "DG", "nuc_id": "D.416. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.297, "mc": 0.0}, "pp": {"sc": 8.611, "mc": 0.248}, "total": 30.125, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "400", "sse_basa": {"sc": 15.375, "total": 17.269, "mc": 1.894}, "sse_chain": "A", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 12.89, "total": 12.89, "sg": 0.0}, "sse_id": "A.139. ", "nuc_name": "DG", "nuc_id": "E.400. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 28.265, "mc": 1.894}, "total": 30.159, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.mc", "pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "415", "sse_basa": {"sc": 23.013, "total": 23.013, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 20.42, "pp": 10.496, "total": 30.915, "sg": 0.0}, "sse_id": "A.268. ", "nuc_name": "DG", "nuc_id": "F.415. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 31.192, "mc": 0.0}, "pp": {"sc": 17.578, "mc": 0.0}, "total": 53.928, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "415", "sse_basa": {"sc": 4.215, "total": 4.215, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 3.437, "pp": 0.577, "total": 4.014, "sg": 0.0}, "sse_id": "HG3", "nuc_name": "DG", "nuc_id": "D.415. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 6.882, "mc": 0.0}, "pp": {"sc": 1.183, "mc": 0.0}, "total": 8.228, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "415", "sse_basa": {"sc": 23.013, "total": 23.013, "mc": 0.0}, "sse_chain": "G", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 20.42, "pp": 10.496, "total": 30.915, "sg": 0.0}, "sse_id": "G.268. ", "nuc_name": "DG", "nuc_id": "D.415. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 31.192, "mc": 0.0}, "pp": {"sc": 17.578, "mc": 0.0}, "total": 53.928, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "400", "sse_basa": {"sc": 8.521, "total": 10.415, "mc": 1.894}, "sse_chain": "G", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 9.497, "total": 9.497, "sg": 0.0}, "sse_id": "G.139. ", "nuc_name": "DG", "nuc_id": "C.400. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 18.018, "mc": 1.894}, "total": 19.911, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.mc", "pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "415", "sse_basa": {"sc": 4.215, "total": 4.215, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 3.437, "pp": 0.577, "total": 4.014, "sg": 0.0}, "sse_id": "HA3", "nuc_name": "DG", "nuc_id": "F.415. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 6.882, "mc": 0.0}, "pp": {"sc": 1.183, "mc": 0.0}, "total": 8.228, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "400", "sse_basa": {"sc": 33.817, "total": 37.201, "mc": 3.384}, "sse_chain": "A", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 1.967, "sr": 14.14, "pp": 19.545, "total": 35.653, "sg": 0.0}, "sse_id": "A.138. ", "nuc_name": "DG", "nuc_id": "E.400. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 3.084, "mc": 0.0}, "sr": {"sc": 20.577, "mc": 0.0}, "pp": {"sc": 28.564, "mc": 4.621}, "total": 72.854, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "417", "sse_basa": {"sc": 0.099, "total": 0.099, "mc": 0.0}, "sse_chain": "A", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.196, "sr": 0.0, "pp": 0.0, "total": 0.196, "sg": 0.0}, "sse_id": "HA3", "nuc_name": "DT", "nuc_id": "F.417. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.295, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 0.295, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}], "residue_data": [{"nucleotide_interaction_count": 3, "helicoidal_coordinates": {"phi": 2.53, "s": 41.535, "rho": 11.957}, "interacting_nucleotides": ["D.417. ", "C.402. ", "D.416. "], "basa_sum": {"sc": 12.681000000000001, "total": 12.681000000000001, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["wg"], "vdw_interaction_sum": {"wg": {"sc": 5, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.300. ", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.472, "s": 15.527, "rho": 12.721}, "interacting_nucleotides": ["F.416. ", "F.415. "], "basa_sum": {"sc": 22.897, "total": 23.009999999999998, "mc": 0.112}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.261. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 1.912, "s": 13.004, "rho": 17.666}, "interacting_nucleotides": ["F.415. "], "basa_sum": {"sc": 33.403, "total": 33.403, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 7, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.293. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.51, "s": 49.881, "rho": 13.245}, "interacting_nucleotides": ["D.416. ", "D.415. "], "basa_sum": {"sc": 22.897, "total": 23.009999999999998, "mc": 0.112}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.261. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 1.75, "s": 10.093, "rho": 12.748}, "interacting_nucleotides": ["F.416. "], "basa_sum": {"sc": 1.204, "total": 1.204, "mc": 0.0}, "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.295. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.648, "s": 7.181, "rho": 10.534}, "interacting_nucleotides": ["F.416. ", "F.417. "], "basa_sum": {"sc": 21.857, "total": 25.555999999999997, "mc": 3.699}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.296. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.684, "s": 41.535, "rho": 11.136}, "interacting_nucleotides": ["D.417. ", "D.416. "], "basa_sum": {"sc": 21.857, "total": 25.555999999999997, "mc": 3.699}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.296. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.607, "s": 19.797, "rho": 13.675}, "interacting_nucleotides": ["E.407. ", "F.415. "], "basa_sum": {"sc": 54.621, "total": 54.621, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.268. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 3, "helicoidal_coordinates": {"phi": 2.547, "s": 7.181, "rho": 11.268}, "interacting_nucleotides": ["F.416. ", "F.417. ", "E.402. "], "basa_sum": {"sc": 12.681000000000001, "total": 12.681000000000001, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["wg"], "vdw_interaction_sum": {"wg": {"sc": 5, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.300. ", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 2.264, "s": 33.189, "rho": 12.056}, "interacting_nucleotides": ["E.409. ", "C.400. "], "basa_sum": {"sc": 39.089, "total": 40.983000000000004, "mc": 1.894}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 3, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.139. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 2.371, "s": 44.64, "rho": 12.945}, "interacting_nucleotides": ["D.416. ", "D.415. "], "basa_sum": {"sc": 4.366, "total": 4.366, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.301. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.637, "s": 54.151, "rho": 14.259}, "interacting_nucleotides": ["D.415. ", "C.407. "], "basa_sum": {"sc": 54.621, "total": 54.621, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.268. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 1.925, "s": 47.357, "rho": 18.347}, "interacting_nucleotides": ["D.415. "], "basa_sum": {"sc": 33.403, "total": 33.403, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 7, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.293. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 2.031, "s": 40.758, "rho": 10.501}, "interacting_nucleotides": ["D.417. ", "D.416. "], "basa_sum": {"sc": 11.807, "total": 12.039000000000001, "mc": 0.232}, "interacts_by": ["sc"], "interacts_with": ["wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.297. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 2.016, "s": 6.405, "rho": 9.799}, "interacting_nucleotides": ["F.416. ", "F.417. "], "basa_sum": {"sc": 11.807, "total": 12.039000000000001, "mc": 0.232}, "interacts_by": ["sc"], "interacts_with": ["wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.297. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 2.378, "s": 10.287, "rho": 12.232}, "interacting_nucleotides": ["F.416. ", "F.415. "], "basa_sum": {"sc": 4.366, "total": 4.366, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.301. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 2.472, "s": 35.906, "rho": 13.026}, "interacting_nucleotides": ["C.400. "], "basa_sum": {"sc": 33.817, "total": 37.201, "mc": 3.384}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.138. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 1.776, "s": 44.446, "rho": 13.385}, "interacting_nucleotides": ["D.416. "], "basa_sum": {"sc": 1.204, "total": 1.204, "mc": 0.0}, "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_id": "G.295. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 2.265, "s": 0.0, "rho": 11.394}, "interacting_nucleotides": ["E.400. "], "basa_sum": {"sc": 15.375, "total": 17.269, "mc": 1.894}, "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.139. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 2.486, "s": 1.553, "rho": 12.326}, "interacting_nucleotides": ["E.400. "], "basa_sum": {"sc": 33.817, "total": 37.201, "mc": 3.384}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "A.138. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}], "interface_features": [{"residue_ids": ["A.261. ", "A.301. ", "A.296. ", "A.300. ", "A.139. ", "A.295. ", "A.268. ", "A.293. ", "A.297. ", "A.138. "], "psuedo-stack_interaction_ratio": 0.0, "psuedo-pair_interaction_ratio": 0.058823529411764705, "secondary_structure_composition": "helix/strand", "residue_propensities": {"CYS": 0.0742, "ASP": -0.0402, "SER": 0.1304, "GLN": -0.0886, "LYS": 0.0539, "ILE": -0.0179, "PRO": -0.1122, "THR": -0.0728, "PHE": -0.0269, "ALA": 0.0585, "GLY": -0.0295, "HIS": -0.0432, "GLU": -0.0837, "LEU": -0.048, "ARG": 0.3102, "TRP": -0.0026, "VAL": -0.0642, "ASN": -0.0489, "TYR": -0.0261, "MET": -0.0101}, "weak_interaction_count": 3, "interaction_count": 17, "protein_chain_id": "A", "interaction_moiety_summary": {"wg": {"H": 2, "S": 0, "L": 2}, "sr": {"H": 1, "S": 1, "L": 6}, "pp": {"H": 0, "S": 1, "L": 7}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "protein_surface_geometry": {"cv_coarse": {"flat_ratio": 0.31540876590112665, "valley_ratio": 0.09295974449044443, "peak_ratio": 0.591631489608429}, "cv_fine": {"flat_ratio": 0.5386416851206418, "valley_ratio": 0.424997732306924, "peak_ratio": 0.03636058257243412}}, "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 2, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 56.089000000000006, "mc": 3.108}, "pp": {"sc": 139.728, "mc": 7.474}, "sr": {"sc": 173.113, "mc": 0.0}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 24.052, "S": 0.0, "L": 35.145}, "sr": {"H": 6.882, "S": 7.062, "L": 159.169}, "pp": {"H": 2.209, "S": 40.67, "L": 104.32299999999998}, "sg": {"H": 0.0, "S": 0.0, "L": 0.0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 442.896, "sg": {"sc": 0.0, "mc": 0.0}}, "mean_hydrophobicity_score": -1.3715014121167206, "vdw_sum": {"wg": {"sc": 6, "mc": 0}, "pp": {"sc": 8, "mc": 2}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 5, "S": 0, "L": 1}, "sr": {"H": 0, "S": 1, "L": 2}, "pp": {"H": 0, "S": 6, "L": 4}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 19, "sg": {"sc": 0, "mc": 0}}, "segment_ids": ["A1"]}, {"residue_ids": ["G.268. ", "G.139. ", "G.301. ", "G.296. ", "G.293. ", "G.300. ", "G.295. ", "G.138. ", "G.261. ", "G.297. "], "psuedo-stack_interaction_ratio": 0.0, "psuedo-pair_interaction_ratio": 0.05555555555555555, "secondary_structure_composition": "helix/strand", "residue_propensities": {"CYS": 0.0742, "ASP": -0.04, "SER": 0.1255, "GLN": -0.0819, "LYS": 0.0588, "ILE": -0.0259, "PRO": -0.1105, "THR": -0.0745, "PHE": -0.0286, "ALA": 0.0528, "GLY": -0.0267, "HIS": -0.044, "GLU": -0.0879, "LEU": -0.0428, "ARG": 0.3144, "TRP": -0.0019, "VAL": -0.0631, "ASN": -0.0476, "TYR": -0.0288, "MET": -0.01}, "weak_interaction_count": 3, "interaction_count": 18, "protein_chain_id": "G", "interaction_moiety_summary": {"wg": {"H": 2, "S": 0, "L": 2}, "sr": {"H": 1, "S": 1, "L": 7}, "pp": {"H": 0, "S": 1, "L": 8}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "protein_surface_geometry": {"cv_coarse": {"flat_ratio": 0.388565756867917, "valley_ratio": 0.028988958373858287, "peak_ratio": 0.5824452847582245}, "cv_fine": {"flat_ratio": 0.5872243783684773, "valley_ratio": 0.39061775845187874, "peak_ratio": 0.022157863179643886}}, "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 3, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 3}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 56.089000000000006, "mc": 3.108}, "pp": {"sc": 172.23299999999998, "mc": 7.474000000000001}, "sr": {"sc": 178.52400000000003, "mc": 0.0}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 24.052, "S": 0.0, "L": 35.145}, "sr": {"H": 6.882, "S": 7.062, "L": 164.58}, "pp": {"H": 2.209, "S": 40.67, "L": 136.82800000000003}, "sg": {"H": 0.0, "S": 0.0, "L": 0.0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 491.666, "sg": {"sc": 0.0, "mc": 0.0}}, "mean_hydrophobicity_score": -1.3714355413165615, "vdw_sum": {"wg": {"sc": 6, "mc": 0}, "pp": {"sc": 11, "mc": 2}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 5, "S": 0, "L": 1}, "sr": {"H": 0, "S": 1, "L": 2}, "pp": {"H": 0, "S": 6, "L": 7}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 22, "sg": {"sc": 0, "mc": 0}}, "segment_ids": ["G1"]}], "binding_site1": "GAACCGGTTCGAACCGGTTC", "binding_site2": "CTTGGCCAAGCTTGGCC", "nucleotide-residue_interactions": [{"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.171, "nuc_basa": {"wg": 0.196, "sr": 0.0, "pp": 0.0, "total": 0.196, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "417", "res_chain": "G", "res_basa": {"sc": 0.099, "total": 0.099, "mc": 0.0}, "basa": {"wg": {"sc": 0.295, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 0.295, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 7.311, "nuc_id": "D.417. ", "res_ins": " ", "geometry": "none", "res_id": "G.300. ", "cm_distance": 11.287}, {"residue_interaction_moieties": ["sc"], "res_number": "261", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.755, "nuc_basa": {"wg": 0.0, "sr": 9.177, "pp": 7.844, "total": 17.021, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.356, "nuc_atom": "C5'", "nuc_moiety": "sr", "res_atom": "OG"}], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [{"res_moiety": "sc", "distance": 2.76, "res_atom": "OG", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "A", "res_basa": {"sc": 12.992, "total": 13.105, "mc": 0.112}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.297, "mc": 0.0}, "pp": {"sc": 8.611, "mc": 0.248}, "total": 30.125, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.289, "nuc_id": "F.416. ", "res_ins": " ", "geometry": "none", "res_id": "A.261. ", "cm_distance": 8.473}, {"residue_interaction_moieties": ["sc"], "res_number": "293", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "S", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.092, "nuc_basa": {"wg": 0.0, "sr": 4.527, "pp": 22.143, "total": 26.67, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.59, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 3.793, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.295, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.092, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 3.829, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 3.821, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.346, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "NH2"}], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [{"res_moiety": "sc", "distance": 3.3, "res_atom": "NH1", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "total": 7, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "415", "res_chain": "A", "res_basa": {"sc": 33.403, "total": 33.403, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 7.062, "mc": 0.0}, "pp": {"sc": 40.67, "mc": 0.0}, "total": 60.073, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 6.77, "nuc_id": "F.415. ", "res_ins": " ", "geometry": "none", "res_id": "A.293. ", "cm_distance": 10.231}, {"residue_interaction_moieties": ["sc"], "res_number": "261", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.077, "nuc_basa": {"wg": 0.0, "sr": 7.53, "pp": 0.0, "total": 7.53, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "415", "res_chain": "G", "res_basa": {"sc": 9.905, "total": 9.905, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.196, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 17.435, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 5.434, "nuc_id": "D.415. ", "res_ins": " ", "geometry": "none", "res_id": "G.261. ", "cm_distance": 8.363}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "295", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.141, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 1.952, "total": 1.952, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "mc", "distance": 3.872, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "C"}, {"res_moiety": "sc", "distance": 3.794, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CA"}], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "A", "res_basa": {"sc": 1.204, "total": 1.204, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 3.114, "mc": 0.0}, "total": 3.157, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 4.028, "nuc_id": "F.416. ", "res_ins": " ", "geometry": "none", "res_id": "A.295. ", "cm_distance": 8.04}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "296", "res_name": "ALA", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.022, "nuc_basa": {"wg": 0.334, "sr": 11.794, "pp": 0.275, "total": 12.403, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.823, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CA"}, {"res_moiety": "mc", "distance": 3.022, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "N"}, {"res_moiety": "sc", "distance": 3.755, "nuc_atom": "C2'", "nuc_moiety": "sr", "res_atom": "CB"}], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [{"res_moiety": "mc", "distance": 3.02, "res_atom": "N", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP2", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "A", "res_basa": {"sc": 15.619, "total": 17.432, "mc": 1.814}, "basa": {"wg": {"sc": 0.352, "mc": 0.0}, "sr": {"sc": 15.708, "mc": 0.0}, "pp": {"sc": 0.297, "mc": 0.479}, "total": 29.836, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 3.939, "nuc_id": "F.416. ", "res_ins": " ", "geometry": "none", "res_id": "A.296. ", "cm_distance": 5.942}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "296", "res_name": "ALA", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.453, "nuc_basa": {"wg": 7.247, "sr": 0.0, "pp": 3.111, "total": 10.358, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "417", "res_chain": "A", "res_basa": {"sc": 6.238, "total": 8.124, "mc": 1.885}, "basa": {"wg": {"sc": 10.851, "mc": 3.108}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 5.746, "mc": 0.0}, "total": 18.482, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "wg.mc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"], "mean_nn_distance": 5.19, "nuc_id": "F.417. ", "res_ins": " ", "geometry": "none", "res_id": "A.296. ", "cm_distance": 7.833}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "296", "res_name": "ALA", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.022, "nuc_basa": {"wg": 0.334, "sr": 11.794, "pp": 0.275, "total": 12.403, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.823, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CA"}, {"res_moiety": "mc", "distance": 3.022, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "N"}, {"res_moiety": "sc", "distance": 3.755, "nuc_atom": "C2'", "nuc_moiety": "sr", "res_atom": "CB"}], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [{"res_moiety": "mc", "distance": 3.02, "res_atom": "N", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP2", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "G", "res_basa": {"sc": 15.619, "total": 17.432, "mc": 1.814}, "basa": {"wg": {"sc": 0.352, "mc": 0.0}, "sr": {"sc": 15.708, "mc": 0.0}, "pp": {"sc": 0.297, "mc": 0.479}, "total": 29.836, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 3.939, "nuc_id": "D.416. ", "res_ins": " ", "geometry": "none", "res_id": "G.296. ", "cm_distance": 5.942}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "296", "res_name": "ALA", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.453, "nuc_basa": {"wg": 7.247, "sr": 0.0, "pp": 3.111, "total": 10.358, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "417", "res_chain": "G", "res_basa": {"sc": 6.238, "total": 8.124, "mc": 1.885}, "basa": {"wg": {"sc": 10.851, "mc": 3.108}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 5.746, "mc": 0.0}, "total": 18.482, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "wg.mc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"], "mean_nn_distance": 5.19, "nuc_id": "D.417. ", "res_ins": " ", "geometry": "none", "res_id": "G.296. ", "cm_distance": 7.833}, {"residue_interaction_moieties": ["sc"], "res_number": "268", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.346, "nuc_basa": {"wg": 0.0, "sr": 32.607, "pp": 2.093, "total": 34.7, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "407", "res_chain": "A", "res_basa": {"sc": 31.608, "total": 31.608, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 57.199, "mc": 0.0}, "pp": {"sc": 3.913, "mc": 0.0}, "total": 66.307, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 6.149, "nuc_id": "E.407. ", "res_ins": " ", "geometry": "none", "res_id": "A.268. ", "cm_distance": 8.637}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.547, "nuc_basa": {"wg": 11.108, "sr": 0.0, "pp": 0.0, "total": 11.108, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.547, "nuc_atom": "N6", "nuc_moiety": "wg", "res_atom": "NH1"}], "nuc_name": "DA", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "402", "res_chain": "G", "res_basa": {"sc": 3.465, "total": 3.465, "mc": 0.0}, "basa": {"wg": {"sc": 14.169, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 14.573, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 7.042, "nuc_id": "C.402. ", "res_ins": " ", "geometry": "none", "res_id": "G.300. ", "cm_distance": 11.058}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.547, "nuc_basa": {"wg": 11.108, "sr": 0.0, "pp": 0.0, "total": 11.108, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.547, "nuc_atom": "N6", "nuc_moiety": "wg", "res_atom": "NH1"}], "nuc_name": "DA", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "402", "res_chain": "A", "res_basa": {"sc": 3.465, "total": 3.465, "mc": 0.0}, "basa": {"wg": {"sc": 14.169, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 14.573, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 7.042, "nuc_id": "E.402. ", "res_ins": " ", "geometry": "none", "res_id": "A.300. ", "cm_distance": 11.058}, {"residue_interaction_moieties": ["sc"], "res_number": "139", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.342, "nuc_basa": {"wg": 0.0, "sr": 3.6, "pp": 24.85, "total": 28.45, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.683, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.359, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.342, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "OG"}], "nuc_name": "DC", "nuc_chain": "E", "hbonds": [{"res_moiety": "sc", "distance": 3.36, "res_atom": "OG", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 3, "mc": 0}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "409", "res_chain": "G", "res_basa": {"sc": 30.568, "total": 30.568, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 5.411, "mc": 0.0}, "pp": {"sc": 42.752, "mc": 0.0}, "total": 59.018, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 5.175, "nuc_id": "E.409. ", "res_ins": " ", "geometry": "none", "res_id": "G.139. ", "cm_distance": 7.684}, {"residue_interaction_moieties": ["sc"], "res_number": "301", "res_name": "ASP", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.168, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.523, "total": 0.523, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "G", "res_basa": {"sc": 0.151, "total": 0.151, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.674, "mc": 0.0}, "total": 0.674, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 6.701, "nuc_id": "D.416. ", "res_ins": " ", "geometry": "none", "res_id": "G.301. ", "cm_distance": 10.024}, {"residue_interaction_moieties": ["sc"], "res_number": "268", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.346, "nuc_basa": {"wg": 0.0, "sr": 32.607, "pp": 2.093, "total": 34.7, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "407", "res_chain": "G", "res_basa": {"sc": 31.608, "total": 31.608, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 57.199, "mc": 0.0}, "pp": {"sc": 3.913, "mc": 0.0}, "total": 66.307, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 6.149, "nuc_id": "C.407. ", "res_ins": " ", "geometry": "none", "res_id": "G.268. ", "cm_distance": 8.637}, {"residue_interaction_moieties": ["sc"], "res_number": "293", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "S", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.092, "nuc_basa": {"wg": 0.0, "sr": 4.527, "pp": 22.143, "total": 26.67, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.59, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 3.793, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.295, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.092, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 3.829, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 3.821, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.346, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "NH2"}], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [{"res_moiety": "sc", "distance": 3.3, "res_atom": "NH1", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "total": 7, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "415", "res_chain": "G", "res_basa": {"sc": 33.403, "total": 33.403, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 7.062, "mc": 0.0}, "pp": {"sc": 40.67, "mc": 0.0}, "total": 60.073, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 6.77, "nuc_id": "D.415. ", "res_ins": " ", "geometry": "none", "res_id": "G.293. ", "cm_distance": 10.231}, {"residue_interaction_moieties": ["sc"], "res_number": "261", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.077, "nuc_basa": {"wg": 0.0, "sr": 7.53, "pp": 0.0, "total": 7.53, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "415", "res_chain": "A", "res_basa": {"sc": 9.905, "total": 9.905, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.196, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 17.435, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 5.434, "nuc_id": "F.415. ", "res_ins": " ", "geometry": "none", "res_id": "A.261. ", "cm_distance": 8.363}, {"residue_interaction_moieties": ["sc"], "res_number": "297", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.053, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.077, "total": 0.077, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "G", "res_basa": {"sc": 0.786, "total": 1.018, "mc": 0.232}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.761, "mc": 0.232}, "total": 1.095, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 5.052, "nuc_id": "D.416. ", "res_ins": " ", "geometry": "none", "res_id": "G.297. ", "cm_distance": 7.381}, {"residue_interaction_moieties": ["sc"], "res_number": "297", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.053, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.077, "total": 0.077, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "A", "res_basa": {"sc": 0.786, "total": 1.018, "mc": 0.232}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.761, "mc": 0.232}, "total": 1.095, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 5.052, "nuc_id": "F.416. ", "res_ins": " ", "geometry": "none", "res_id": "A.297. ", "cm_distance": 7.381}, {"residue_interaction_moieties": ["sc"], "res_number": "297", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.781, "nuc_basa": {"wg": 6.729, "sr": 0.0, "pp": 0.0, "total": 6.729, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.781, "nuc_atom": "C7", "nuc_moiety": "wg", "res_atom": "SG"}], "nuc_name": "DT", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "417", "res_chain": "A", "res_basa": {"sc": 11.021, "total": 11.021, "mc": 0.0}, "basa": {"wg": {"sc": 17.75, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 17.75, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 6.072, "nuc_id": "F.417. ", "res_ins": " ", "geometry": "none", "res_id": "A.297. ", "cm_distance": 9.535}, {"residue_interaction_moieties": ["sc"], "res_number": "301", "res_name": "ASP", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.168, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.523, "total": 0.523, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "A", "res_basa": {"sc": 0.151, "total": 0.151, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.674, "mc": 0.0}, "total": 0.674, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 6.701, "nuc_id": "F.416. ", "res_ins": " ", "geometry": "none", "res_id": "A.301. ", "cm_distance": 10.024}, {"residue_interaction_moieties": ["sc"], "res_number": "297", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.781, "nuc_basa": {"wg": 6.729, "sr": 0.0, "pp": 0.0, "total": 6.729, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.781, "nuc_atom": "C7", "nuc_moiety": "wg", "res_atom": "SG"}], "nuc_name": "DT", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "417", "res_chain": "G", "res_basa": {"sc": 11.021, "total": 11.021, "mc": 0.0}, "basa": {"wg": {"sc": 17.75, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 17.75, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 6.072, "nuc_id": "D.417. ", "res_ins": " ", "geometry": "none", "res_id": "G.297. ", "cm_distance": 9.535}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "138", "res_name": "LYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.232, "nuc_basa": {"wg": 1.967, "sr": 14.14, "pp": 19.545, "total": 35.653, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "400", "res_chain": "G", "res_basa": {"sc": 33.817, "total": 37.201, "mc": 3.384}, "basa": {"wg": {"sc": 3.084, "mc": 0.0}, "sr": {"sc": 20.577, "mc": 0.0}, "pp": {"sc": 28.564, "mc": 4.621}, "total": 72.854, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.672, "nuc_id": "C.400. ", "res_ins": " ", "geometry": "none", "res_id": "G.138. ", "cm_distance": 7.282}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "295", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.141, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 1.952, "total": 1.952, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "mc", "distance": 3.872, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "C"}, {"res_moiety": "sc", "distance": 3.794, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CA"}], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "G", "res_basa": {"sc": 1.204, "total": 1.204, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 3.114, "mc": 0.0}, "total": 3.157, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 4.028, "nuc_id": "D.416. ", "res_ins": " ", "geometry": "none", "res_id": "G.295. ", "cm_distance": 8.04}, {"residue_interaction_moieties": ["sc"], "res_number": "261", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.755, "nuc_basa": {"wg": 0.0, "sr": 9.177, "pp": 7.844, "total": 17.021, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.356, "nuc_atom": "C5'", "nuc_moiety": "sr", "res_atom": "OG"}], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [{"res_moiety": "sc", "distance": 2.76, "res_atom": "OG", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "G", "res_basa": {"sc": 12.992, "total": 13.105, "mc": 0.112}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.297, "mc": 0.0}, "pp": {"sc": 8.611, "mc": 0.248}, "total": 30.125, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.289, "nuc_id": "D.416. ", "res_ins": " ", "geometry": "none", "res_id": "G.261. ", "cm_distance": 8.473}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "139", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.463, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 12.89, "total": 12.89, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "400", "res_chain": "A", "res_basa": {"sc": 15.375, "total": 17.269, "mc": 1.894}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 28.265, "mc": 1.894}, "total": 30.159, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 5.426, "nuc_id": "E.400. ", "res_ins": " ", "geometry": "none", "res_id": "A.139. ", "cm_distance": 8.856}, {"residue_interaction_moieties": ["sc"], "res_number": "268", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.036, "nuc_basa": {"wg": 0.0, "sr": 20.42, "pp": 10.496, "total": 30.915, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "415", "res_chain": "A", "res_basa": {"sc": 23.013, "total": 23.013, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 31.192, "mc": 0.0}, "pp": {"sc": 17.578, "mc": 0.0}, "total": 53.928, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 5.705, "nuc_id": "F.415. ", "res_ins": " ", "geometry": "none", "res_id": "A.268. ", "cm_distance": 9.057}, {"residue_interaction_moieties": ["sc"], "res_number": "301", "res_name": "ASP", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.495, "nuc_basa": {"wg": 0.0, "sr": 3.437, "pp": 0.577, "total": 4.014, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "415", "res_chain": "G", "res_basa": {"sc": 4.215, "total": 4.215, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 6.882, "mc": 0.0}, "pp": {"sc": 1.183, "mc": 0.0}, "total": 8.228, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 6.276, "nuc_id": "D.415. ", "res_ins": " ", "geometry": "none", "res_id": "G.301. ", "cm_distance": 8.513}, {"residue_interaction_moieties": ["sc"], "res_number": "268", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.036, "nuc_basa": {"wg": 0.0, "sr": 20.42, "pp": 10.496, "total": 30.915, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "415", "res_chain": "G", "res_basa": {"sc": 23.013, "total": 23.013, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 31.192, "mc": 0.0}, "pp": {"sc": 17.578, "mc": 0.0}, "total": 53.928, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 5.705, "nuc_id": "D.415. ", "res_ins": " ", "geometry": "none", "res_id": "G.268. ", "cm_distance": 9.057}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "139", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.463, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 9.497, "total": 9.497, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "400", "res_chain": "G", "res_basa": {"sc": 8.521, "total": 10.415, "mc": 1.894}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 18.018, "mc": 1.894}, "total": 19.911, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 5.426, "nuc_id": "C.400. ", "res_ins": " ", "geometry": "none", "res_id": "G.139. ", "cm_distance": 8.856}, {"residue_interaction_moieties": ["sc"], "res_number": "301", "res_name": "ASP", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.495, "nuc_basa": {"wg": 0.0, "sr": 3.437, "pp": 0.577, "total": 4.014, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "415", "res_chain": "A", "res_basa": {"sc": 4.215, "total": 4.215, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 6.882, "mc": 0.0}, "pp": {"sc": 1.183, "mc": 0.0}, "total": 8.228, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 6.276, "nuc_id": "F.415. ", "res_ins": " ", "geometry": "none", "res_id": "A.301. ", "cm_distance": 8.513}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "138", "res_name": "LYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.232, "nuc_basa": {"wg": 1.967, "sr": 14.14, "pp": 19.545, "total": 35.653, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "400", "res_chain": "A", "res_basa": {"sc": 33.817, "total": 37.201, "mc": 3.384}, "basa": {"wg": {"sc": 3.084, "mc": 0.0}, "sr": {"sc": 20.577, "mc": 0.0}, "pp": {"sc": 28.564, "mc": 4.621}, "total": 72.854, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.672, "nuc_id": "E.400. ", "res_ins": " ", "geometry": "none", "res_id": "A.138. ", "cm_distance": 7.282}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.791, "nuc_basa": {"wg": 8.781, "sr": 0.0, "pp": 0.027, "total": 8.808, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.577, "nuc_atom": "C8", "nuc_moiety": "wg", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 2.791, "nuc_atom": "N7", "nuc_moiety": "wg", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 3.776, "nuc_atom": "N7", "nuc_moiety": "wg", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 3.322, "nuc_atom": "O6", "nuc_moiety": "wg", "res_atom": "NH1"}], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [{"res_moiety": "sc", "distance": 2.79, "res_atom": "NH2", "nuc_moiety": "wg", "water_id": "NA", "nuc_atom": "N7", "distance_WA": "NA"}, {"res_moiety": "sc", "distance": 3.32, "res_atom": "NH1", "nuc_moiety": "wg", "water_id": "NA", "nuc_atom": "O6", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 4, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "G", "res_basa": {"sc": 9.117, "total": 9.117, "mc": 0.0}, "basa": {"wg": {"sc": 9.588, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.352, "mc": 0.0}, "total": 17.925, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 6.583, "nuc_id": "D.416. ", "res_ins": " ", "geometry": "pseudo_pair", "res_id": "G.300. ", "cm_distance": 8.81}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.791, "nuc_basa": {"wg": 8.781, "sr": 0.0, "pp": 0.027, "total": 8.808, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.577, "nuc_atom": "C8", "nuc_moiety": "wg", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 2.791, "nuc_atom": "N7", "nuc_moiety": "wg", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 3.776, "nuc_atom": "N7", "nuc_moiety": "wg", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 3.322, "nuc_atom": "O6", "nuc_moiety": "wg", "res_atom": "NH1"}], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [{"res_moiety": "sc", "distance": 2.79, "res_atom": "NH2", "nuc_moiety": "wg", "water_id": "NA", "nuc_atom": "N7", "distance_WA": "NA"}, {"res_moiety": "sc", "distance": 3.32, "res_atom": "NH1", "nuc_moiety": "wg", "water_id": "NA", "nuc_atom": "O6", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 4, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "416", "res_chain": "A", "res_basa": {"sc": 9.117, "total": 9.117, "mc": 0.0}, "basa": {"wg": {"sc": 9.588, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.352, "mc": 0.0}, "total": 17.925, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 6.583, "nuc_id": "F.416. ", "res_ins": " ", "geometry": "pseudo_pair", "res_id": "A.300. ", "cm_distance": 8.81}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.171, "nuc_basa": {"wg": 0.196, "sr": 0.0, "pp": 0.0, "total": 0.196, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "417", "res_chain": "A", "res_basa": {"sc": 0.099, "total": 0.099, "mc": 0.0}, "basa": {"wg": {"sc": 0.295, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 0.295, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 7.311, "nuc_id": "F.417. ", "res_ins": " ", "geometry": "none", "res_id": "A.300. ", "cm_distance": 11.287}], "nucleotide_data": [{"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 3, "basa_sum": {"wg": 14.172, "pp": 3.111, "sr": 0.0, "secondary_structure": {"wg": {"H": 0.196, "S": 0, "L": 13.975999999999999}, "sr": {"H": 0.0, "S": 0, "L": 0.0}, "pp": {"H": 0.0, "S": 0, "L": 3.111}, "sg": {"H": 0.0, "S": 0, "L": 0.0}}, "total": 17.283, "sg": 0.0}, "nuc_id": "D.417. ", "interacts_by": ["wg", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 6, "basa_sum": {"wg": 9.115, "pp": 10.697999999999999, "sr": 20.971, "secondary_structure": {"wg": {"H": 8.781, "S": 0, "L": 0.334}, "sr": {"H": 0.0, "S": 0, "L": 20.971}, "pp": {"H": 0.55, "S": 0, "L": 10.148}, "sg": {"H": 0.0, "S": 0, "L": 0.0}}, "total": 40.784, "sg": 0.0}, "nuc_id": "F.416. ", "interacts_by": ["sr", "wg", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 4, "mc": 0}, "pp": {"sc": 2, "mc": 2}, "sr": {"sc": 2, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 10, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 4, "basa_sum": {"wg": 0.0, "pp": 33.216, "sr": 35.914, "secondary_structure": {"wg": {"H": 0.0, "S": 0.0, "L": 0.0}, "sr": {"H": 3.437, "S": 4.527, "L": 27.950000000000003}, "pp": {"H": 0.577, "S": 22.143, "L": 10.496}, "sg": {"H": 0.0, "S": 0.0, "L": 0.0}}, "total": 69.129, "sg": 0.0}, "nuc_id": "F.415. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 7, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 4, "basa_sum": {"wg": 0.0, "pp": 33.216, "sr": 35.914, "secondary_structure": {"wg": {"H": 0.0, "S": 0.0, "L": 0.0}, "sr": {"H": 3.437, "S": 4.527, "L": 27.950000000000003}, "pp": {"H": 0.577, "S": 22.143, "L": 10.496}, "sg": {"H": 0.0, "S": 0.0, "L": 0.0}}, "total": 69.129, "sg": 0.0}, "nuc_id": "D.415. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 7, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 3, "basa_sum": {"wg": 14.171999999999999, "pp": 3.111, "sr": 0.0, "secondary_structure": {"wg": {"H": 0.196, "S": 0, "L": 13.975999999999999}, "sr": {"H": 0.0, "S": 0, "L": 0.0}, "pp": {"H": 0.0, "S": 0, "L": 3.111}, "sg": {"H": 0.0, "S": 0, "L": 0.0}}, "total": 17.283, "sg": 0.0}, "nuc_id": "F.417. ", "interacts_by": ["wg", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 6, "basa_sum": {"wg": 9.115, "pp": 10.697999999999999, "sr": 20.971, "secondary_structure": {"wg": {"H": 8.781, "S": 0, "L": 0.334}, "sr": {"H": 0.0, "S": 0, "L": 20.971}, "pp": {"H": 0.55, "S": 0, "L": 10.148}, "sg": {"H": 0.0, "S": 0, "L": 0.0}}, "total": 40.784, "sg": 0.0}, "nuc_id": "D.416. ", "interacts_by": ["sr", "wg", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 4, "mc": 0}, "pp": {"sc": 2, "mc": 2}, "sr": {"sc": 2, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 10, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 2.093, "sr": 32.607, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 32.607}, "pp": {"H": 0, "S": 0, "L": 2.093}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 34.7, "sg": 0.0}, "nuc_id": "E.407. ", "interacts_by": ["sr"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 11.108, "pp": 0.0, "sr": 0.0, "secondary_structure": {"wg": {"H": 11.108, "S": 0, "L": 0}, "sr": {"H": 0.0, "S": 0, "L": 0}, "pp": {"H": 0.0, "S": 0, "L": 0}, "sg": {"H": 0.0, "S": 0, "L": 0}}, "total": 11.108, "sg": 0.0}, "nuc_id": "C.402. ", "interacts_by": ["wg"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 11.108, "pp": 0.0, "sr": 0.0, "secondary_structure": {"wg": {"H": 11.108, "S": 0, "L": 0}, "sr": {"H": 0.0, "S": 0, "L": 0}, "pp": {"H": 0.0, "S": 0, "L": 0}, "sg": {"H": 0.0, "S": 0, "L": 0}}, "total": 11.108, "sg": 0.0}, "nuc_id": "E.402. ", "interacts_by": ["wg"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 1}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 24.85, "sr": 3.6, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 3.6}, "pp": {"H": 0, "S": 0, "L": 24.85}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 28.45, "sg": 0.0}, "nuc_id": "E.409. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 3, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 1}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 3, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 2.093, "sr": 32.607, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 32.607}, "pp": {"H": 0, "S": 0, "L": 2.093}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 34.7, "sg": 0.0}, "nuc_id": "C.407. ", "interacts_by": ["sr"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 2, "basa_sum": {"wg": 1.967, "pp": 29.042, "sr": 14.14, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 1.967}, "sr": {"H": 0, "S": 0, "L": 14.14}, "pp": {"H": 0, "S": 0, "L": 29.042}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 45.15, "sg": 0.0}, "nuc_id": "C.400. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 2, "basa_sum": {"wg": 1.967, "pp": 32.435, "sr": 14.14, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 1.967}, "sr": {"H": 0, "S": 0, "L": 14.14}, "pp": {"H": 0, "S": 0, "L": 32.435}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 48.543, "sg": 0.0}, "nuc_id": "E.400. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}], "protein_chains": ["A", "G"], "pro_entity_id": "A1@G1", "sse_data": [{"nucleotide_interaction_count": 5, "helicoidal_coordinates": {"phi": 2.576, "s": 45.805, "rho": 15.955}, "interacting_nucleotides": ["C.402. ", "D.416. ", "D.415. ", "D.417. "], "basa_sum": {"sc": 17.047, "total": 17.047, "mc": 0.0}, "sse_id": "HG3", "interacts_by": ["sc"], "interacts_with": ["wg", "sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 5, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.472, "s": 15.527, "rho": 12.721}, "interacting_nucleotides": ["F.416. ", "F.415. "], "basa_sum": {"sc": 22.897, "total": 23.009999999999998, "mc": 0.112}, "sse_id": "A.261. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 1.963, "s": 13.974, "rho": 30.329}, "interacting_nucleotides": ["F.415. "], "basa_sum": {"sc": 33.403, "total": 33.403, "mc": 0.0}, "sse_id": "SA11", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 7, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.51, "s": 49.881, "rho": 13.245}, "interacting_nucleotides": ["D.416. ", "D.415. "], "basa_sum": {"sc": 22.897, "total": 23.009999999999998, "mc": 0.112}, "sse_id": "G.261. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 1.75, "s": 10.093, "rho": 12.748}, "interacting_nucleotides": ["F.416. "], "basa_sum": {"sc": 1.204, "total": 1.204, "mc": 0.0}, "sse_id": "A.295. ", "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.648, "s": 7.181, "rho": 10.534}, "interacting_nucleotides": ["F.416. ", "F.417. "], "basa_sum": {"sc": 21.857, "total": 25.555999999999997, "mc": 3.699}, "sse_id": "A.296. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.684, "s": 41.535, "rho": 11.136}, "interacting_nucleotides": ["D.417. ", "D.416. "], "basa_sum": {"sc": 21.857, "total": 25.555999999999997, "mc": 3.699}, "sse_id": "G.296. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.607, "s": 19.797, "rho": 13.675}, "interacting_nucleotides": ["E.407. ", "F.415. "], "basa_sum": {"sc": 54.621, "total": 54.621, "mc": 0.0}, "sse_id": "A.268. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 5, "helicoidal_coordinates": {"phi": 2.591, "s": 11.451, "rho": 15.277}, "interacting_nucleotides": ["F.416. ", "F.415. ", "F.417. ", "E.402. "], "basa_sum": {"sc": 17.047, "total": 17.047, "mc": 0.0}, "sse_id": "HA3", "interacts_by": ["sc"], "interacts_with": ["wg", "sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 5, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 2.264, "s": 33.189, "rho": 12.056}, "interacting_nucleotides": ["E.409. ", "C.400. "], "basa_sum": {"sc": 39.089, "total": 40.983000000000004, "mc": 1.894}, "sse_id": "G.139. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 3, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 3, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 1.637, "s": 54.151, "rho": 14.259}, "interacting_nucleotides": ["D.415. ", "C.407. "], "basa_sum": {"sc": 54.621, "total": 54.621, "mc": 0.0}, "sse_id": "G.268. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 1.97, "s": 48.328, "rho": 31.021}, "interacting_nucleotides": ["D.415. "], "basa_sum": {"sc": 33.403, "total": 33.403, "mc": 0.0}, "sse_id": "SG11", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 6, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 7, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 2.031, "s": 40.758, "rho": 10.501}, "interacting_nucleotides": ["D.417. ", "D.416. "], "basa_sum": {"sc": 11.807, "total": 12.039000000000001, "mc": 0.232}, "sse_id": "G.297. ", "interacts_by": ["sc"], "interacts_with": ["wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 2.016, "s": 6.405, "rho": 9.799}, "interacting_nucleotides": ["F.416. ", "F.417. "], "basa_sum": {"sc": 11.807, "total": 12.039000000000001, "mc": 0.232}, "sse_id": "A.297. ", "interacts_by": ["sc"], "interacts_with": ["wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 2.472, "s": 35.906, "rho": 13.026}, "interacting_nucleotides": ["C.400. "], "basa_sum": {"sc": 33.817, "total": 37.201, "mc": 3.384}, "sse_id": "G.138. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 1.776, "s": 44.446, "rho": 13.385}, "interacting_nucleotides": ["D.416. "], "basa_sum": {"sc": 1.204, "total": 1.204, "mc": 0.0}, "sse_id": "G.295. ", "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 2.265, "s": 0.0, "rho": 11.394}, "interacting_nucleotides": ["E.400. "], "basa_sum": {"sc": 15.375, "total": 17.269, "mc": 1.894}, "sse_id": "A.139. ", "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 2.486, "s": 1.553, "rho": 12.326}, "interacting_nucleotides": ["E.400. "], "basa_sum": {"sc": 33.817, "total": 37.201, "mc": 3.384}, "sse_id": "A.138. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}]}, {"dna_entity_id": "C1@D1@E1@F1", "nucleotide-sse_interactions": [{"nuc_number": "411", "sse_basa": {"sc": 7.132, "total": 7.132, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 7.855, "total": 7.855, "sg": 0.0}, "sse_id": "B.138. ", "nuc_name": "DA", "nuc_id": "F.411. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 14.987, "mc": 0.0}, "total": 14.987, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "405", "sse_basa": {"sc": 27.997, "total": 27.997, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 3.215, "pp": 21.739, "total": 24.954, "sg": 0.0}, "sse_id": "SH11", "nuc_name": "DG", "nuc_id": "C.405. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 4.865, "mc": 0.0}, "pp": {"sc": 38.279, "mc": 0.0}, "total": 52.951, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "total": 10, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "406", "sse_basa": {"sc": 11.827, "total": 13.744, "mc": 1.917}, "sse_chain": "B", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.138, "sr": 7.671, "pp": 1.205, "total": 9.014, "sg": 0.0}, "sse_id": "B.296. ", "nuc_name": "DG", "nuc_id": "E.406. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.138, "mc": 0.0}, "sr": {"sc": 10.964, "mc": 0.0}, "pp": {"sc": 1.252, "mc": 0.598}, "total": 22.758, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 1}, "pp": {"sc": 1, "mc": 1}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc", "sr.mc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "406", "sse_basa": {"sc": 11.827, "total": 13.744, "mc": 1.917}, "sse_chain": "H", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.138, "sr": 7.671, "pp": 1.205, "total": 9.014, "sg": 0.0}, "sse_id": "H.296. ", "nuc_name": "DG", "nuc_id": "C.406. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.138, "mc": 0.0}, "sr": {"sc": 10.964, "mc": 0.0}, "pp": {"sc": 1.252, "mc": 0.598}, "total": 22.758, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 1}, "pp": {"sc": 1, "mc": 1}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc", "sr.mc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "419", "sse_basa": {"sc": 35.865, "total": 35.982, "mc": 0.118}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 10.741, "pp": 20.296, "total": 31.036, "sg": 0.0}, "sse_id": "B.139. ", "nuc_name": "DC", "nuc_id": "D.419. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 18.623, "mc": 0.195}, "pp": {"sc": 34.693, "mc": 0.0}, "total": 67.018, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "410", "sse_basa": {"sc": 39.645, "total": 41.402, "mc": 1.757}, "sse_chain": "H", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 1.844, "sr": 32.156, "pp": 6.383, "total": 40.383, "sg": 0.0}, "sse_id": "H.138. ", "nuc_name": "DG", "nuc_id": "D.410. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 3.521, "mc": 0.0}, "sr": {"sc": 49.446, "mc": 0.0}, "pp": {"sc": 10.114, "mc": 2.558}, "total": 81.785, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "406", "sse_basa": {"sc": 0.057, "total": 0.417, "mc": 0.36}, "sse_chain": "B", "residue_interaction_moieties": ["mc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.212, "total": 0.212, "sg": 0.0}, "sse_id": "B.297. ", "nuc_name": "DG", "nuc_id": "E.406. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.269, "mc": 0.36}, "total": 0.629, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.mc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "411", "sse_basa": {"sc": 7.132, "total": 7.132, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 7.855, "total": 7.855, "sg": 0.0}, "sse_id": "H.138. ", "nuc_name": "DA", "nuc_id": "D.411. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 14.987, "mc": 0.0}, "total": 14.987, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "405", "sse_basa": {"sc": 16.614, "total": 16.614, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 12.429, "sr": 3.285, "pp": 0.0, "total": 15.714, "sg": 0.0}, "sse_id": "HH3", "nuc_name": "DG", "nuc_id": "C.405. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 20.719, "mc": 0.0}, "sr": {"sc": 5.116, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 32.328, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "wg.sc"], "nucleotide_interaction_moieties": ["sr", "wg"]}, {"nuc_number": "407", "sse_basa": {"sc": 1.626, "total": 1.626, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 1.499, "sr": 0.0, "pp": 0.0, "total": 1.499, "sg": 0.0}, "sse_id": "HH3", "nuc_name": "DT", "nuc_id": "C.407. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 3.126, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 3.126, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "418", "sse_basa": {"sc": 28.827, "total": 28.827, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 21.697, "pp": 9.544, "total": 31.241, "sg": 0.0}, "sse_id": "H.268. ", "nuc_name": "DT", "nuc_id": "D.418. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 36.572, "mc": 0.0}, "pp": {"sc": 17.92, "mc": 0.0}, "total": 60.068, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 2, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "405", "sse_basa": {"sc": 16.614, "total": 16.614, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 12.429, "sr": 3.285, "pp": 0.0, "total": 15.714, "sg": 0.0}, "sse_id": "HB3", "nuc_name": "DG", "nuc_id": "E.405. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 20.719, "mc": 0.0}, "sr": {"sc": 5.116, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 32.328, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "wg.sc"], "nucleotide_interaction_moieties": ["sr", "wg"]}, {"nuc_number": "406", "sse_basa": {"sc": 14.549, "total": 14.549, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 14.07, "pp": 1.473, "total": 15.543, "sg": 0.0}, "sse_id": "H.259. ", "nuc_name": "DG", "nuc_id": "C.406. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 24.245, "mc": 0.0}, "pp": {"sc": 1.473, "mc": 0.0}, "total": 30.092, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "418", "sse_basa": {"sc": 28.827, "total": 28.827, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 21.697, "pp": 9.544, "total": 31.241, "sg": 0.0}, "sse_id": "B.268. ", "nuc_name": "DT", "nuc_id": "F.418. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 36.572, "mc": 0.0}, "pp": {"sc": 17.92, "mc": 0.0}, "total": 60.068, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 2, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "417", "sse_basa": {"sc": 15.127, "total": 15.127, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 18.969, "pp": 0.0, "total": 18.969, "sg": 0.0}, "sse_id": "H.268. ", "nuc_name": "DT", "nuc_id": "D.417. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 34.096, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 34.096, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "406", "sse_basa": {"sc": 0.057, "total": 0.417, "mc": 0.36}, "sse_chain": "H", "residue_interaction_moieties": ["mc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.212, "total": 0.212, "sg": 0.0}, "sse_id": "H.297. ", "nuc_name": "DG", "nuc_id": "C.406. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.269, "mc": 0.36}, "total": 0.629, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.mc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "407", "sse_basa": {"sc": 10.84, "total": 11.191, "mc": 0.351}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 9.073, "sr": 0.0, "pp": 5.061, "total": 14.134, "sg": 0.0}, "sse_id": "H.296. ", "nuc_name": "DT", "nuc_id": "C.407. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 15.705, "mc": 0.531}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 9.151, "mc": 0.0}, "total": 25.326, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"]}, {"nuc_number": "405", "sse_basa": {"sc": 27.997, "total": 27.997, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 3.215, "pp": 21.739, "total": 24.954, "sg": 0.0}, "sse_id": "SB11", "nuc_name": "DG", "nuc_id": "E.405. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 4.865, "mc": 0.0}, "pp": {"sc": 38.279, "mc": 0.0}, "total": 52.951, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "total": 10, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "406", "sse_basa": {"sc": 1.709, "total": 1.709, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 1.063, "total": 1.063, "sg": 0.0}, "sse_id": "H.295. ", "nuc_name": "DG", "nuc_id": "C.406. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 2.299, "mc": 0.0}, "total": 2.772, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.mc", "pp.sc"], "nucleotide_interaction_moieties": ["pp"]}, {"nuc_number": "405", "sse_basa": {"sc": 11.816, "total": 11.816, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 8.956, "pp": 0.0, "total": 8.956, "sg": 0.0}, "sse_id": "B.261. ", "nuc_name": "DG", "nuc_id": "E.405. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.347, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 20.771, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 6, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "407", "sse_basa": {"sc": 1.626, "total": 1.626, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 1.499, "sr": 0.0, "pp": 0.0, "total": 1.499, "sg": 0.0}, "sse_id": "HB3", "nuc_name": "DT", "nuc_id": "E.407. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 3.126, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 3.126, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "406", "sse_basa": {"sc": 8.039, "total": 8.187, "mc": 0.148}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 5.433, "pp": 5.381, "total": 10.814, "sg": 0.0}, "sse_id": "H.261. ", "nuc_name": "DG", "nuc_id": "C.406. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 11.047, "mc": 0.254}, "pp": {"sc": 5.381, "mc": 0.0}, "total": 19.001, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "406", "sse_basa": {"sc": 8.039, "total": 8.187, "mc": 0.148}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 5.433, "pp": 5.381, "total": 10.814, "sg": 0.0}, "sse_id": "B.261. ", "nuc_name": "DG", "nuc_id": "E.406. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 11.047, "mc": 0.254}, "pp": {"sc": 5.381, "mc": 0.0}, "total": 19.001, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "412", "sse_basa": {"sc": 8.9, "total": 8.9, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 11.139, "sr": 0.0, "pp": 0.0, "total": 11.139, "sg": 0.0}, "sse_id": "HB3", "nuc_name": "DA", "nuc_id": "F.412. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 19.975, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 20.038, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "410", "sse_basa": {"sc": 37.143, "total": 38.901, "mc": 1.757}, "sse_chain": "B", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 1.844, "sr": 32.156, "pp": 6.283, "total": 40.283, "sg": 0.0}, "sse_id": "B.138. ", "nuc_name": "DG", "nuc_id": "F.410. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 3.51, "mc": 0.0}, "sr": {"sc": 49.446, "mc": 0.0}, "pp": {"sc": 9.138, "mc": 2.558}, "total": 79.183, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"]}, {"nuc_number": "406", "sse_basa": {"sc": 6.197, "total": 6.197, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 11.83, "sr": 0.0, "pp": 1.259, "total": 13.088, "sg": 0.0}, "sse_id": "HB3", "nuc_name": "DG", "nuc_id": "E.406. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 12.697, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 2.58, "mc": 0.0}, "total": 19.286, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "412", "sse_basa": {"sc": 8.9, "total": 8.9, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 11.139, "sr": 0.0, "pp": 0.0, "total": 11.139, "sg": 0.0}, "sse_id": "HH3", "nuc_name": "DA", "nuc_id": "D.412. ", "nuc_chain": "D", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 19.975, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 20.038, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": "417", "sse_basa": {"sc": 15.127, "total": 15.127, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 18.969, "pp": 0.0, "total": 18.969, "sg": 0.0}, "sse_id": "B.268. ", "nuc_name": "DT", "nuc_id": "F.417. ", "nuc_chain": "F", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 34.096, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 34.096, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "406", "sse_basa": {"sc": 6.197, "total": 6.197, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 11.83, "sr": 0.0, "pp": 1.259, "total": 13.088, "sg": 0.0}, "sse_id": "HH3", "nuc_name": "DG", "nuc_id": "C.406. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 12.697, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 2.58, "mc": 0.0}, "total": 19.286, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"]}, {"nuc_number": 404, "sse_basa": {"sc": 0, "total": 0, "mc": 0}, "sse_chain": "B", "residue_interaction_moieties": [null], "nuc_basa": {"wg": 0, "sr": 0, "pp": 0, "total": 0, "sg": 0}, "sse_id": "SB11", "nuc_name": "DC", "nuc_id": "E.404. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["None.None"], "nucleotide_interaction_moieties": [null]}, {"nuc_number": "406", "sse_basa": {"sc": 14.549, "total": 14.549, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 14.07, "pp": 1.473, "total": 15.543, "sg": 0.0}, "sse_id": "B.259. ", "nuc_name": "DG", "nuc_id": "E.406. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 24.245, "mc": 0.0}, "pp": {"sc": 1.473, "mc": 0.0}, "total": 30.092, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": "405", "sse_basa": {"sc": 11.816, "total": 11.816, "mc": 0.0}, "sse_chain": "H", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 0.0, "sr": 8.956, "pp": 0.0, "total": 8.956, "sg": 0.0}, "sse_id": "H.261. ", "nuc_name": "DG", "nuc_id": "C.405. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.347, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 20.771, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 6, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"]}, {"nuc_number": 404, "sse_basa": {"sc": 0, "total": 0, "mc": 0}, "sse_chain": "H", "residue_interaction_moieties": [null], "nuc_basa": {"wg": 0, "sr": 0, "pp": 0, "total": 0, "sg": 0}, "sse_id": "SH11", "nuc_name": "DC", "nuc_id": "C.404. ", "nuc_chain": "C", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["None.None"], "nucleotide_interaction_moieties": [null]}, {"nuc_number": "407", "sse_basa": {"sc": 10.84, "total": 11.191, "mc": 0.351}, "sse_chain": "B", "residue_interaction_moieties": ["sc"], "nuc_basa": {"wg": 9.073, "sr": 0.0, "pp": 5.061, "total": 14.134, "sg": 0.0}, "sse_id": "B.296. ", "nuc_name": "DT", "nuc_id": "E.407. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 15.705, "mc": 0.531}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 9.151, "mc": 0.0}, "total": 25.326, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.sc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"]}, {"nuc_number": "406", "sse_basa": {"sc": 1.709, "total": 1.709, "mc": 0.0}, "sse_chain": "B", "residue_interaction_moieties": ["sc", "mc"], "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 1.063, "total": 1.063, "sg": 0.0}, "sse_id": "B.295. ", "nuc_name": "DG", "nuc_id": "E.406. ", "nuc_chain": "E", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 2.299, "mc": 0.0}, "total": 2.772, "sg": {"sc": 0.0, "mc": 0.0}}, "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "moiety_interactions": ["pp.mc", "pp.sc"], "nucleotide_interaction_moieties": ["pp"]}], "residue_data": [{"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": -0.723, "s": 30.084, "rho": 12.773}, "interacting_nucleotides": ["F.410. ", "F.411. "], "basa_sum": {"sc": 44.275, "total": 46.033, "mc": 1.757}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.138. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": -0.129, "s": 52.404, "rho": 17.565}, "interacting_nucleotides": ["C.405. ", "C.404. "], "basa_sum": {"sc": 27.997, "total": 27.997, "mc": 0.0}, "interacts_by": [null, "sc"], "interacts_with": [null, "sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 10, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.293. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.074, "s": 23.679, "rho": 10.793}, "interacting_nucleotides": ["E.407. ", "E.406. "], "basa_sum": {"sc": 22.667, "total": 24.935000000000002, "mc": 2.268}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 1, "mc": 1}, "bs": {"sc": 0, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.296. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.131, "s": 58.032, "rho": 10.404}, "interacting_nucleotides": ["C.406. ", "C.407. "], "basa_sum": {"sc": 22.667, "total": 24.935000000000002, "mc": 2.268}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 1, "mc": 1}, "bs": {"sc": 0, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.296. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": -0.472, "s": 32.025, "rho": 11.827}, "interacting_nucleotides": ["D.419. "], "basa_sum": {"sc": 35.865, "total": 35.982, "mc": 0.118}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.139. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": -0.712, "s": 64.243, "rho": 12.066}, "interacting_nucleotides": ["D.410. ", "D.411. "], "basa_sum": {"sc": 46.777, "total": 48.534, "mc": 1.757}, "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.138. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": -0.275, "s": 24.649, "rho": 10.613}, "interacting_nucleotides": ["E.406. "], "basa_sum": {"sc": 0.057, "total": 0.417, "mc": 0.36}, "interacts_by": ["mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.297. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 4, "helicoidal_coordinates": {"phi": -0.727, "s": 58.226, "rho": 11.495}, "interacting_nucleotides": ["D.412. ", "C.406. ", "C.405. ", "C.407. "], "basa_sum": {"sc": 33.337, "total": 33.337, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "wg"], "vdw_interaction_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.300. ", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.152, "s": 45.611, "rho": 13.213}, "interacting_nucleotides": ["D.417. ", "D.418. "], "basa_sum": {"sc": 43.954, "total": 43.954, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.268. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 4, "helicoidal_coordinates": {"phi": -0.737, "s": 23.873, "rho": 12.204}, "interacting_nucleotides": ["F.412. ", "E.405. ", "E.406. ", "E.407. "], "basa_sum": {"sc": 33.337, "total": 33.337, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "wg"], "vdw_interaction_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.300. ", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 0.311, "s": 53.18, "rho": 16.062}, "interacting_nucleotides": ["C.406. "], "basa_sum": {"sc": 14.549, "total": 14.549, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.259. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.106, "s": 11.257, "rho": 13.585}, "interacting_nucleotides": ["F.417. ", "F.418. "], "basa_sum": {"sc": 43.954, "total": 43.954, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.268. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": -0.233, "s": 59.003, "rho": 10.038}, "interacting_nucleotides": ["C.406. "], "basa_sum": {"sc": 0.057, "total": 0.417, "mc": 0.36}, "interacts_by": ["mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.297. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": -0.157, "s": 18.05, "rho": 18.089}, "interacting_nucleotides": ["E.404. ", "E.405. "], "basa_sum": {"sc": 27.997, "total": 27.997, "mc": 0.0}, "interacts_by": [null, "sc"], "interacts_with": [null, "sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 10, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.293. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 0.03, "s": 55.315, "rho": 12.652}, "interacting_nucleotides": ["C.406. "], "basa_sum": {"sc": 1.709, "total": 1.709, "mc": 0.0}, "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.295. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.233, "s": 14.945, "rho": 13.12}, "interacting_nucleotides": ["E.405. ", "E.406. "], "basa_sum": {"sc": 19.855, "total": 20.003, "mc": 0.148}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 6, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.261. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.283, "s": 49.298, "rho": 12.83}, "interacting_nucleotides": ["C.405. ", "C.406. "], "basa_sum": {"sc": 19.855, "total": 20.003, "mc": 0.148}, "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 6, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "res_id": "H.261. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 0.269, "s": 18.827, "rho": 16.33}, "interacting_nucleotides": ["E.406. "], "basa_sum": {"sc": 14.549, "total": 14.549, "mc": 0.0}, "interacts_by": ["sc"], "interacts_with": ["sr"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.259. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": -0.014, "s": 20.961, "rho": 13.096}, "interacting_nucleotides": ["E.406. "], "basa_sum": {"sc": 1.709, "total": 1.709, "mc": 0.0}, "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_id": "B.295. ", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}], "interface_features": [{"residue_ids": ["B.300. ", "B.259. ", "B.261. ", "B.296. ", "B.295. ", "B.293. ", "B.297. ", "B.138. ", "B.139. ", "B.268. "], "psuedo-stack_interaction_ratio": 0.0, "psuedo-pair_interaction_ratio": 0.05555555555555555, "secondary_structure_composition": "helix/strand", "residue_propensities": {"CYS": 0.0758, "ASP": -0.0679, "SER": 0.1004, "GLN": -0.0728, "LYS": 0.0852, "ILE": -0.0234, "PRO": -0.1023, "THR": -0.0796, "PHE": -0.0317, "ALA": 0.0428, "GLY": -0.0242, "HIS": -0.047, "GLU": -0.0857, "LEU": -0.046, "ARG": 0.3069, "TRP": -0.0023, "VAL": -0.0621, "ASN": -0.0068, "TYR": -0.0368, "MET": -0.0107}, "weak_interaction_count": 3, "interaction_count": 18, "protein_chain_id": "B", "interaction_moiety_summary": {"wg": {"H": 3, "S": 0, "L": 1}, "sr": {"H": 1, "S": 1, "L": 8}, "pp": {"H": 0, "S": 1, "L": 8}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "protein_surface_geometry": {"cv_coarse": {"flat_ratio": 0.39709746976243676, "valley_ratio": 0.026939605249524958, "peak_ratio": 0.5759629249880386}, "cv_fine": {"flat_ratio": 0.5889946524374648, "valley_ratio": 0.3875150690187472, "peak_ratio": 0.023490278543788223}}, "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 3, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 3}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 75.87, "mc": 0.531}, "pp": {"sc": 137.42200000000003, "mc": 3.516}, "sr": {"sc": 212.321, "mc": 0.449}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 56.51700000000001, "S": 0.0, "L": 19.884}, "sr": {"H": 5.116, "S": 4.865, "L": 202.78900000000004}, "pp": {"H": 2.58, "S": 38.279, "L": 100.07900000000001}, "sg": {"H": 0.0, "S": 0.0, "L": 0.0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 504.42999999999995, "sg": {"sc": 0.0, "mc": 0.0}}, "mean_hydrophobicity_score": -1.3418137012036448, "vdw_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 11, "mc": 2}, "sr": {"sc": 14, "mc": 1}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 3, "L": 12}, "pp": {"H": 0, "S": 7, "L": 6}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 30, "sg": {"sc": 0, "mc": 0}}, "segment_ids": ["B1"]}, {"residue_ids": ["H.295. ", "H.300. ", "H.261. ", "H.138. ", "H.259. ", "H.293. ", "H.297. ", "H.268. ", "H.296. "], "psuedo-stack_interaction_ratio": 0.0, "psuedo-pair_interaction_ratio": 0.058823529411764705, "secondary_structure_composition": "helix/strand", "residue_propensities": {"CYS": 0.0844, "ASP": -0.0674, "SER": 0.0071, "GLN": -0.0813, "LYS": 0.1002, "ILE": -0.0161, "PRO": -0.1023, "THR": -0.0775, "PHE": -0.0303, "ALA": 0.0566, "GLY": -0.0259, "HIS": -0.0458, "GLU": -0.0819, "LEU": -0.0513, "ARG": 0.3442, "TRP": -0.0033, "VAL": -0.0646, "ASN": -0.0027, "TYR": -0.0341, "MET": -0.0105}, "weak_interaction_count": 3, "interaction_count": 17, "protein_chain_id": "H", "interaction_moiety_summary": {"wg": {"H": 3, "S": 0, "L": 1}, "sr": {"H": 1, "S": 1, "L": 7}, "pp": {"H": 0, "S": 1, "L": 7}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "protein_surface_geometry": {"cv_coarse": {"flat_ratio": 0.2971044976861916, "valley_ratio": 0.08685431867341686, "peak_ratio": 0.616041183640392}, "cv_fine": {"flat_ratio": 0.578728004046247, "valley_ratio": 0.4063401011421504, "peak_ratio": 0.014931894811602979}}, "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 3, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 3}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "basa": {"wg": {"sc": 75.881, "mc": 0.531}, "pp": {"sc": 103.70500000000001, "mc": 3.5159999999999996}, "sr": {"sc": 193.698, "mc": 0.254}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 56.51700000000001, "S": 0.0, "L": 19.895}, "sr": {"H": 5.116, "S": 4.865, "L": 183.971}, "pp": {"H": 2.58, "S": 38.279, "L": 66.362}, "sg": {"H": 0.0, "S": 0.0, "L": 0.0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 440.014, "sg": {"sc": 0.0, "mc": 0.0}}, "mean_hydrophobicity_score": -1.4097810652048834, "vdw_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 11, "mc": 2}, "sr": {"sc": 14, "mc": 1}, "bs": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 3, "L": 12}, "pp": {"H": 0, "S": 7, "L": 6}, "sg": {"H": 0, "S": 0, "L": 0}, "bs": {"H": 0, "S": 0, "L": 0}}, "total": 30, "sg": {"sc": 0, "mc": 0}}, "segment_ids": ["H1"]}], "binding_site1": "ACCGGTTCGAACCGGTTC", "binding_site2": "CTTGGCCAAGCTTGGCCAAG", "nucleotide-residue_interactions": [{"residue_interaction_moieties": ["sc"], "res_number": "138", "res_name": "LYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.493, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 7.855, "total": 7.855, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DA", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "411", "res_chain": "B", "res_basa": {"sc": 7.132, "total": 7.132, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 14.987, "mc": 0.0}, "total": 14.987, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 7.71, "nuc_id": "F.411. ", "res_ins": " ", "geometry": "none", "res_id": "B.138. ", "cm_distance": 9.671}, {"residue_interaction_moieties": ["sc"], "res_number": "293", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "S", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.654, "nuc_basa": {"wg": 0.0, "sr": 3.215, "pp": 21.739, "total": 24.954, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.835, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 2.949, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.345, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 3.684, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 3.279, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.711, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 2.758, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.739, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 2.654, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.802, "nuc_atom": "C3'", "nuc_moiety": "sr", "res_atom": "NH1"}], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [{"res_moiety": "sc", "distance": 3.34, "res_atom": "NH2", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "total": 10, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "405", "res_chain": "H", "res_basa": {"sc": 27.997, "total": 27.997, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 4.865, "mc": 0.0}, "pp": {"sc": 38.279, "mc": 0.0}, "total": 52.951, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 6.488, "nuc_id": "C.405. ", "res_ins": " ", "geometry": "none", "res_id": "H.293. ", "cm_distance": 9.911}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "296", "res_name": "ALA", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.963, "nuc_basa": {"wg": 0.138, "sr": 7.671, "pp": 1.205, "total": 9.014, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "mc", "distance": 2.963, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "N"}, {"res_moiety": "sc", "distance": 3.895, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CA"}, {"res_moiety": "mc", "distance": 3.885, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "N"}, {"res_moiety": "sc", "distance": 3.812, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "CB"}], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [{"res_moiety": "mc", "distance": 2.96, "res_atom": "N", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP2", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 1}, "pp": {"sc": 1, "mc": 1}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "B", "res_basa": {"sc": 11.827, "total": 13.744, "mc": 1.917}, "basa": {"wg": {"sc": 0.138, "mc": 0.0}, "sr": {"sc": 10.964, "mc": 0.0}, "pp": {"sc": 1.252, "mc": 0.598}, "total": 22.758, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc", "sr.mc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.139, "nuc_id": "E.406. ", "res_ins": " ", "geometry": "none", "res_id": "B.296. ", "cm_distance": 6.13}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "296", "res_name": "ALA", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.963, "nuc_basa": {"wg": 0.138, "sr": 7.671, "pp": 1.205, "total": 9.014, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "mc", "distance": 2.963, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "N"}, {"res_moiety": "sc", "distance": 3.895, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CA"}, {"res_moiety": "mc", "distance": 3.885, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "N"}, {"res_moiety": "sc", "distance": 3.812, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "CB"}], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [{"res_moiety": "mc", "distance": 2.96, "res_atom": "N", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP2", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 1}, "pp": {"sc": 1, "mc": 1}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "H", "res_basa": {"sc": 11.827, "total": 13.744, "mc": 1.917}, "basa": {"wg": {"sc": 0.138, "mc": 0.0}, "sr": {"sc": 10.964, "mc": 0.0}, "pp": {"sc": 1.252, "mc": 0.598}, "total": 22.758, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc", "sr.mc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.139, "nuc_id": "C.406. ", "res_ins": " ", "geometry": "none", "res_id": "H.296. ", "cm_distance": 6.13}, {"residue_interaction_moieties": ["sc"], "res_number": "139", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.125, "nuc_basa": {"wg": 0.0, "sr": 10.741, "pp": 20.296, "total": 31.036, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DC", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "419", "res_chain": "B", "res_basa": {"sc": 35.865, "total": 35.982, "mc": 0.118}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 18.623, "mc": 0.195}, "pp": {"sc": 34.693, "mc": 0.0}, "total": 67.018, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 5.16, "nuc_id": "D.419. ", "res_ins": " ", "geometry": "none", "res_id": "B.139. ", "cm_distance": 7.5}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "138", "res_name": "LYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.835, "nuc_basa": {"wg": 1.844, "sr": 32.156, "pp": 6.383, "total": 40.383, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.835, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "CD"}], "nuc_name": "DG", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "410", "res_chain": "H", "res_basa": {"sc": 39.645, "total": 41.402, "mc": 1.757}, "basa": {"wg": {"sc": 3.521, "mc": 0.0}, "sr": {"sc": 49.446, "mc": 0.0}, "pp": {"sc": 10.114, "mc": 2.558}, "total": 81.785, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.983, "nuc_id": "D.410. ", "res_ins": " ", "geometry": "none", "res_id": "H.138. ", "cm_distance": 7.126}, {"residue_interaction_moieties": ["mc"], "res_number": "297", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.326, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.212, "total": 0.212, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "B", "res_basa": {"sc": 0.057, "total": 0.417, "mc": 0.36}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.269, "mc": 0.36}, "total": 0.629, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["pp.mc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 5.577, "nuc_id": "E.406. ", "res_ins": " ", "geometry": "none", "res_id": "B.297. ", "cm_distance": 7.845}, {"residue_interaction_moieties": ["sc"], "res_number": "138", "res_name": "LYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.493, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 7.855, "total": 7.855, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DA", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "411", "res_chain": "H", "res_basa": {"sc": 7.132, "total": 7.132, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 14.987, "mc": 0.0}, "total": 14.987, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 7.71, "nuc_id": "D.411. ", "res_ins": " ", "geometry": "none", "res_id": "H.138. ", "cm_distance": 9.671}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.149, "nuc_basa": {"wg": 12.429, "sr": 3.285, "pp": 0.0, "total": 15.714, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "405", "res_chain": "H", "res_basa": {"sc": 16.614, "total": 16.614, "mc": 0.0}, "basa": {"wg": {"sc": 20.719, "mc": 0.0}, "sr": {"sc": 5.116, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 32.328, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "wg.sc"], "nucleotide_interaction_moieties": ["sr", "wg"], "mean_nn_distance": 6.892, "nuc_id": "C.405. ", "res_ins": " ", "geometry": "none", "res_id": "H.300. ", "cm_distance": 8.2}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.464, "nuc_basa": {"wg": 1.499, "sr": 0.0, "pp": 0.0, "total": 1.499, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "407", "res_chain": "H", "res_basa": {"sc": 1.626, "total": 1.626, "mc": 0.0}, "basa": {"wg": {"sc": 3.126, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 3.126, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 7.657, "nuc_id": "C.407. ", "res_ins": " ", "geometry": "none", "res_id": "H.300. ", "cm_distance": 11.64}, {"residue_interaction_moieties": ["sc"], "res_number": "268", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.013, "nuc_basa": {"wg": 0.0, "sr": 21.697, "pp": 9.544, "total": 31.241, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.697, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.013, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.539, "nuc_atom": "C5'", "nuc_moiety": "sr", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.648, "nuc_atom": "C5'", "nuc_moiety": "sr", "res_atom": "NH2"}], "nuc_name": "DT", "nuc_chain": "D", "hbonds": [{"res_moiety": "sc", "distance": 3.01, "res_atom": "NH1", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 2, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "418", "res_chain": "H", "res_basa": {"sc": 28.827, "total": 28.827, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 36.572, "mc": 0.0}, "pp": {"sc": 17.92, "mc": 0.0}, "total": 60.068, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 5.553, "nuc_id": "D.418. ", "res_ins": " ", "geometry": "none", "res_id": "H.268. ", "cm_distance": 8.791}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.149, "nuc_basa": {"wg": 12.429, "sr": 3.285, "pp": 0.0, "total": 15.714, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "405", "res_chain": "B", "res_basa": {"sc": 16.614, "total": 16.614, "mc": 0.0}, "basa": {"wg": {"sc": 20.719, "mc": 0.0}, "sr": {"sc": 5.116, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 32.328, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "wg.sc"], "nucleotide_interaction_moieties": ["sr", "wg"], "mean_nn_distance": 6.892, "nuc_id": "E.405. ", "res_ins": " ", "geometry": "none", "res_id": "B.300. ", "cm_distance": 8.2}, {"residue_interaction_moieties": ["sc"], "res_number": "259", "res_name": "ASN", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.968, "nuc_basa": {"wg": 0.0, "sr": 14.07, "pp": 1.473, "total": 15.543, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "H", "res_basa": {"sc": 14.549, "total": 14.549, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 24.245, "mc": 0.0}, "pp": {"sc": 1.473, "mc": 0.0}, "total": 30.092, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 5.088, "nuc_id": "C.406. ", "res_ins": " ", "geometry": "none", "res_id": "H.259. ", "cm_distance": 9.379}, {"residue_interaction_moieties": ["sc"], "res_number": "268", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.013, "nuc_basa": {"wg": 0.0, "sr": 21.697, "pp": 9.544, "total": 31.241, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.697, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.013, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.539, "nuc_atom": "C5'", "nuc_moiety": "sr", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.648, "nuc_atom": "C5'", "nuc_moiety": "sr", "res_atom": "NH2"}], "nuc_name": "DT", "nuc_chain": "F", "hbonds": [{"res_moiety": "sc", "distance": 3.01, "res_atom": "NH1", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 2, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "418", "res_chain": "B", "res_basa": {"sc": 28.827, "total": 28.827, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 36.572, "mc": 0.0}, "pp": {"sc": 17.92, "mc": 0.0}, "total": 60.068, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 5.553, "nuc_id": "F.418. ", "res_ins": " ", "geometry": "none", "res_id": "B.268. ", "cm_distance": 8.791}, {"residue_interaction_moieties": ["sc"], "res_number": "268", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.257, "nuc_basa": {"wg": 0.0, "sr": 18.969, "pp": 0.0, "total": 18.969, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.257, "nuc_atom": "O3'", "nuc_moiety": "sr", "res_atom": "NH1"}], "nuc_name": "DT", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "417", "res_chain": "H", "res_basa": {"sc": 15.127, "total": 15.127, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 34.096, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 34.096, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 5.921, "nuc_id": "D.417. ", "res_ins": " ", "geometry": "none", "res_id": "H.268. ", "cm_distance": 8.692}, {"residue_interaction_moieties": ["mc"], "res_number": "297", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.326, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 0.212, "total": 0.212, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "H", "res_basa": {"sc": 0.057, "total": 0.417, "mc": 0.36}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.269, "mc": 0.36}, "total": 0.629, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["pp.mc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 5.577, "nuc_id": "C.406. ", "res_ins": " ", "geometry": "none", "res_id": "H.297. ", "cm_distance": 7.845}, {"residue_interaction_moieties": ["sc"], "res_number": "296", "res_name": "ALA", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.017, "nuc_basa": {"wg": 9.073, "sr": 0.0, "pp": 5.061, "total": 14.134, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "407", "res_chain": "H", "res_basa": {"sc": 10.84, "total": 11.191, "mc": 0.351}, "basa": {"wg": {"sc": 15.705, "mc": 0.531}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 9.151, "mc": 0.0}, "total": 25.326, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"], "mean_nn_distance": 5.072, "nuc_id": "C.407. ", "res_ins": " ", "geometry": "none", "res_id": "H.296. ", "cm_distance": 7.88}, {"residue_interaction_moieties": ["sc"], "res_number": "293", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "S", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.654, "nuc_basa": {"wg": 0.0, "sr": 3.215, "pp": 21.739, "total": 24.954, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.835, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 2.949, "nuc_atom": "P", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.345, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "NH2"}, {"res_moiety": "sc", "distance": 3.684, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 3.279, "nuc_atom": "OP1", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.711, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 2.758, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.739, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "CZ"}, {"res_moiety": "sc", "distance": 2.654, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.802, "nuc_atom": "C3'", "nuc_moiety": "sr", "res_atom": "NH1"}], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [{"res_moiety": "sc", "distance": 3.34, "res_atom": "NH2", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "total": 10, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "405", "res_chain": "B", "res_basa": {"sc": 27.997, "total": 27.997, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 4.865, "mc": 0.0}, "pp": {"sc": 38.279, "mc": 0.0}, "total": 52.951, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 6.488, "nuc_id": "E.405. ", "res_ins": " ", "geometry": "none", "res_id": "B.293. ", "cm_distance": 9.911}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "295", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.2, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 1.063, "total": 1.063, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.59, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CA"}, {"res_moiety": "mc", "distance": 3.769, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "C"}], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "H", "res_basa": {"sc": 1.709, "total": 1.709, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 2.299, "mc": 0.0}, "total": 2.772, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 4.06, "nuc_id": "C.406. ", "res_ins": " ", "geometry": "none", "res_id": "H.295. ", "cm_distance": 7.937}, {"residue_interaction_moieties": ["sc"], "res_number": "261", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.47, "nuc_basa": {"wg": 0.0, "sr": 8.956, "pp": 0.0, "total": 8.956, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.613, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.663, "nuc_atom": "C5'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.747, "nuc_atom": "C4'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.47, "nuc_atom": "C3'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.524, "nuc_atom": "O3'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.863, "nuc_atom": "O3'", "nuc_moiety": "sr", "res_atom": "CB"}], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 6, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "405", "res_chain": "B", "res_basa": {"sc": 11.816, "total": 11.816, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.347, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 20.771, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 5.118, "nuc_id": "E.405. ", "res_ins": " ", "geometry": "none", "res_id": "B.261. ", "cm_distance": 7.957}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.464, "nuc_basa": {"wg": 1.499, "sr": 0.0, "pp": 0.0, "total": 1.499, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "407", "res_chain": "B", "res_basa": {"sc": 1.626, "total": 1.626, "mc": 0.0}, "basa": {"wg": {"sc": 3.126, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 3.126, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": true, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 7.657, "nuc_id": "E.407. ", "res_ins": " ", "geometry": "none", "res_id": "B.300. ", "cm_distance": 11.64}, {"residue_interaction_moieties": ["sc"], "res_number": "261", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.536, "nuc_basa": {"wg": 0.0, "sr": 5.433, "pp": 5.381, "total": 10.814, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [{"res_moiety": "sc", "distance": 2.54, "res_atom": "OG", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "H", "res_basa": {"sc": 8.039, "total": 8.187, "mc": 0.148}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 11.047, "mc": 0.254}, "pp": {"sc": 5.381, "mc": 0.0}, "total": 19.001, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.218, "nuc_id": "C.406. ", "res_ins": " ", "geometry": "none", "res_id": "H.261. ", "cm_distance": 8.267}, {"residue_interaction_moieties": ["sc"], "res_number": "261", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 2.536, "nuc_basa": {"wg": 0.0, "sr": 5.433, "pp": 5.381, "total": 10.814, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [{"res_moiety": "sc", "distance": 2.54, "res_atom": "OG", "nuc_moiety": "pp", "water_id": "NA", "nuc_atom": "OP1", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "B", "res_basa": {"sc": 8.039, "total": 8.187, "mc": 0.148}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 11.047, "mc": 0.254}, "pp": {"sc": 5.381, "mc": 0.0}, "total": 19.001, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.218, "nuc_id": "E.406. ", "res_ins": " ", "geometry": "none", "res_id": "B.261. ", "cm_distance": 8.267}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.946, "nuc_basa": {"wg": 11.139, "sr": 0.0, "pp": 0.0, "total": 11.139, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DA", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "412", "res_chain": "B", "res_basa": {"sc": 8.9, "total": 8.9, "mc": 0.0}, "basa": {"wg": {"sc": 19.975, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 20.038, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 7.44, "nuc_id": "F.412. ", "res_ins": " ", "geometry": "none", "res_id": "B.300. ", "cm_distance": 11.647}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "138", "res_name": "LYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.835, "nuc_basa": {"wg": 1.844, "sr": 32.156, "pp": 6.283, "total": 40.283, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.835, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "CD"}], "nuc_name": "DG", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "410", "res_chain": "B", "res_basa": {"sc": 37.143, "total": 38.901, "mc": 1.757}, "basa": {"wg": {"sc": 3.51, "mc": 0.0}, "sr": {"sc": 49.446, "mc": 0.0}, "pp": {"sc": 9.138, "mc": 2.558}, "total": 79.183, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc", "pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["sr", "pp"], "mean_nn_distance": 4.983, "nuc_id": "F.410. ", "res_ins": " ", "geometry": "none", "res_id": "B.138. ", "cm_distance": 7.126}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.017, "nuc_basa": {"wg": 11.83, "sr": 0.0, "pp": 1.259, "total": 13.088, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.017, "nuc_atom": "N7", "nuc_moiety": "wg", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.438, "nuc_atom": "O6", "nuc_moiety": "wg", "res_atom": "NH2"}], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [{"res_moiety": "sc", "distance": 3.02, "res_atom": "NH1", "nuc_moiety": "wg", "water_id": "NA", "nuc_atom": "N7", "distance_WA": "NA"}, {"res_moiety": "sc", "distance": 3.44, "res_atom": "NH2", "nuc_moiety": "wg", "water_id": "NA", "nuc_atom": "O6", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "B", "res_basa": {"sc": 6.197, "total": 6.197, "mc": 0.0}, "basa": {"wg": {"sc": 12.697, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 2.58, "mc": 0.0}, "total": 19.286, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 6.811, "nuc_id": "E.406. ", "res_ins": " ", "geometry": "pseudo_pair", "res_id": "B.300. ", "cm_distance": 9.035}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.946, "nuc_basa": {"wg": 11.139, "sr": 0.0, "pp": 0.0, "total": 11.139, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DA", "nuc_chain": "D", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "412", "res_chain": "H", "res_basa": {"sc": 8.9, "total": 8.9, "mc": 0.0}, "basa": {"wg": {"sc": 19.975, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 20.038, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 7.44, "nuc_id": "D.412. ", "res_ins": " ", "geometry": "none", "res_id": "H.300. ", "cm_distance": 11.647}, {"residue_interaction_moieties": ["sc"], "res_number": "268", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.257, "nuc_basa": {"wg": 0.0, "sr": 18.969, "pp": 0.0, "total": 18.969, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.257, "nuc_atom": "O3'", "nuc_moiety": "sr", "res_atom": "NH1"}], "nuc_name": "DT", "nuc_chain": "F", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "417", "res_chain": "B", "res_basa": {"sc": 15.127, "total": 15.127, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 34.096, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 34.096, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 5.921, "nuc_id": "F.417. ", "res_ins": " ", "geometry": "none", "res_id": "B.268. ", "cm_distance": 8.692}, {"residue_interaction_moieties": ["sc"], "res_number": "300", "res_name": "ARG", "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "H", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.017, "nuc_basa": {"wg": 11.83, "sr": 0.0, "pp": 1.259, "total": 13.088, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.017, "nuc_atom": "N7", "nuc_moiety": "wg", "res_atom": "NH1"}, {"res_moiety": "sc", "distance": 3.438, "nuc_atom": "O6", "nuc_moiety": "wg", "res_atom": "NH2"}], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [{"res_moiety": "sc", "distance": 3.02, "res_atom": "NH1", "nuc_moiety": "wg", "water_id": "NA", "nuc_atom": "N7", "distance_WA": "NA"}, {"res_moiety": "sc", "distance": 3.44, "res_atom": "NH2", "nuc_moiety": "wg", "water_id": "NA", "nuc_atom": "O6", "distance_WA": "NA"}], "vdw_sum": {"wg": {"sc": 2, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "H", "res_basa": {"sc": 6.197, "total": 6.197, "mc": 0.0}, "basa": {"wg": {"sc": 12.697, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 2.58, "mc": 0.0}, "total": 19.286, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["wg.sc"], "nucleotide_interaction_moieties": ["wg"], "mean_nn_distance": 6.811, "nuc_id": "C.406. ", "res_ins": " ", "geometry": "pseudo_pair", "res_id": "H.300. ", "cm_distance": 9.035}, {"residue_interaction_moieties": [null], "res_number": 293, "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "S", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.492, "nuc_basa": {"wg": 0, "sr": 0, "pp": 0, "total": 0, "sg": 0}, "vdw_interactions": [], "nuc_name": "DC", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": 404, "res_chain": "B", "res_basa": {"sc": 0, "total": 0, "mc": 0}, "basa": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "weak_interaction": true, "moiety_interactions": ["None.None"], "nucleotide_interaction_moieties": [null], "mean_nn_distance": 8.514, "nuc_id": "E.404. ", "res_ins": " ", "geometry": "none", "res_id": "B.293. ", "cm_distance": 11.951}, {"residue_interaction_moieties": ["sc"], "res_number": "259", "res_name": "ASN", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.968, "nuc_basa": {"wg": 0.0, "sr": 14.07, "pp": 1.473, "total": 15.543, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "B", "res_basa": {"sc": 14.549, "total": 14.549, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 24.245, "mc": 0.0}, "pp": {"sc": 1.473, "mc": 0.0}, "total": 30.092, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 5.088, "nuc_id": "E.406. ", "res_ins": " ", "geometry": "none", "res_id": "B.259. ", "cm_distance": 9.379}, {"residue_interaction_moieties": ["sc"], "res_number": "261", "res_name": "SER", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.47, "nuc_basa": {"wg": 0.0, "sr": 8.956, "pp": 0.0, "total": 8.956, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.613, "nuc_atom": "O5'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.663, "nuc_atom": "C5'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.747, "nuc_atom": "C4'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.47, "nuc_atom": "C3'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.524, "nuc_atom": "O3'", "nuc_moiety": "sr", "res_atom": "OG"}, {"res_moiety": "sc", "distance": 3.863, "nuc_atom": "O3'", "nuc_moiety": "sr", "res_atom": "CB"}], "nuc_name": "DG", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 6, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "405", "res_chain": "H", "res_basa": {"sc": 11.816, "total": 11.816, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 17.347, "mc": 0.0}, "pp": {"sc": 0.0, "mc": 0.0}, "total": 20.771, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["sr.sc"], "nucleotide_interaction_moieties": ["sr"], "mean_nn_distance": 5.118, "nuc_id": "C.405. ", "res_ins": " ", "geometry": "none", "res_id": "H.261. ", "cm_distance": 7.957}, {"residue_interaction_moieties": [null], "res_number": 293, "res_name": "ARG", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "S", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.492, "nuc_basa": {"wg": 0, "sr": 0, "pp": 0, "total": 0, "sg": 0}, "vdw_interactions": [], "nuc_name": "DC", "nuc_chain": "C", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": 404, "res_chain": "H", "res_basa": {"sc": 0, "total": 0, "mc": 0}, "basa": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "weak_interaction": true, "moiety_interactions": ["None.None"], "nucleotide_interaction_moieties": [null], "mean_nn_distance": 8.514, "nuc_id": "C.404. ", "res_ins": " ", "geometry": "none", "res_id": "H.293. ", "cm_distance": 11.951}, {"residue_interaction_moieties": ["sc"], "res_number": "296", "res_name": "ALA", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 4.017, "nuc_basa": {"wg": 9.073, "sr": 0.0, "pp": 5.061, "total": 14.134, "sg": 0.0}, "vdw_interactions": [], "nuc_name": "DT", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "407", "res_chain": "B", "res_basa": {"sc": 10.84, "total": 11.191, "mc": 0.351}, "basa": {"wg": {"sc": 15.705, "mc": 0.531}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 9.151, "mc": 0.0}, "total": 25.326, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "wg.sc"], "nucleotide_interaction_moieties": ["wg", "pp"], "mean_nn_distance": 5.072, "nuc_id": "E.407. ", "res_ins": " ", "geometry": "none", "res_id": "B.296. ", "cm_distance": 7.88}, {"residue_interaction_moieties": ["sc", "mc"], "res_number": "295", "res_name": "CYS", "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "res_secondary_structure": "L", "nuc_secondary_structure": "helical", "nuc_ins": " ", "min_distance": 3.2, "nuc_basa": {"wg": 0.0, "sr": 0.0, "pp": 1.063, "total": 1.063, "sg": 0.0}, "vdw_interactions": [{"res_moiety": "sc", "distance": 3.59, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "CA"}, {"res_moiety": "mc", "distance": 3.769, "nuc_atom": "OP2", "nuc_moiety": "pp", "res_atom": "C"}], "nuc_name": "DG", "nuc_chain": "E", "hbonds": [], "vdw_sum": {"wg": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "nuc_number": "406", "res_chain": "B", "res_basa": {"sc": 1.709, "total": 1.709, "mc": 0.0}, "basa": {"wg": {"sc": 0.0, "mc": 0.0}, "sr": {"sc": 0.0, "mc": 0.0}, "pp": {"sc": 2.299, "mc": 0.0}, "total": 2.772, "sg": {"sc": 0.0, "mc": 0.0}}, "weak_interaction": false, "moiety_interactions": ["pp.sc", "pp.mc"], "nucleotide_interaction_moieties": ["pp"], "mean_nn_distance": 4.06, "nuc_id": "E.406. ", "res_ins": " ", "geometry": "none", "res_id": "B.295. ", "cm_distance": 7.937}], "nucleotide_data": [{"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 7.855, "sr": 0.0, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 0.0}, "pp": {"H": 0, "S": 0, "L": 7.855}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 7.855, "sg": 0.0}, "nuc_id": "F.411. ", "interacts_by": ["pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 3, "basa_sum": {"wg": 12.429, "pp": 21.739, "sr": 15.456, "secondary_structure": {"wg": {"H": 12.429, "S": 0.0, "L": 0.0}, "sr": {"H": 3.285, "S": 3.215, "L": 8.956}, "pp": {"H": 0.0, "S": 21.739, "L": 0.0}, "sg": {"H": 0.0, "S": 0.0, "L": 0.0}}, "total": 49.623999999999995, "sg": 0.0}, "nuc_id": "C.405. ", "interacts_by": ["sr", "wg", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "sr": {"sc": 9, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 16, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 6, "basa_sum": {"wg": 11.968, "pp": 10.593000000000002, "sr": 27.174, "secondary_structure": {"wg": {"H": 11.83, "S": 0, "L": 0.138}, "sr": {"H": 0.0, "S": 0, "L": 27.174}, "pp": {"H": 1.259, "S": 0, "L": 9.334000000000001}, "sg": {"H": 0.0, "S": 0, "L": 0.0}}, "total": 49.734, "sg": 0.0}, "nuc_id": "E.406. ", "interacts_by": ["sr", "wg", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 2, "mc": 2}, "sr": {"sc": 1, "mc": 1}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 8, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 6, "basa_sum": {"wg": 11.968, "pp": 10.593, "sr": 27.174, "secondary_structure": {"wg": {"H": 11.83, "S": 0, "L": 0.138}, "sr": {"H": 0.0, "S": 0, "L": 27.174}, "pp": {"H": 1.259, "S": 0, "L": 9.334}, "sg": {"H": 0.0, "S": 0, "L": 0.0}}, "total": 49.734, "sg": 0.0}, "nuc_id": "C.406. ", "interacts_by": ["sr", "wg", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 2, "mc": 2}, "sr": {"sc": 1, "mc": 1}, "secondary_structure": {"wg": {"H": 2, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 2}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 8, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 20.296, "sr": 10.741, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 10.741}, "pp": {"H": 0, "S": 0, "L": 20.296}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 31.036, "sg": 0.0}, "nuc_id": "D.419. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 1.844, "pp": 6.383, "sr": 32.156, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 1.844}, "sr": {"H": 0, "S": 0, "L": 32.156}, "pp": {"H": 0, "S": 0, "L": 6.383}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 40.383, "sg": 0.0}, "nuc_id": "D.410. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 7.855, "sr": 0.0, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 0.0}, "pp": {"H": 0, "S": 0, "L": 7.855}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 7.855, "sg": 0.0}, "nuc_id": "D.411. ", "interacts_by": ["pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 2, "basa_sum": {"wg": 10.572000000000001, "pp": 5.061, "sr": 0.0, "secondary_structure": {"wg": {"H": 1.499, "S": 0, "L": 9.073}, "sr": {"H": 0.0, "S": 0, "L": 0.0}, "pp": {"H": 0.0, "S": 0, "L": 5.061}, "sg": {"H": 0.0, "S": 0, "L": 0.0}}, "total": 15.633000000000001, "sg": 0.0}, "nuc_id": "C.407. ", "interacts_by": ["wg", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 1}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 9.544, "sr": 21.697, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 21.697}, "pp": {"H": 0, "S": 0, "L": 9.544}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 31.241, "sg": 0.0}, "nuc_id": "D.418. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "sr": {"sc": 2, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 1}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 4, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 3, "basa_sum": {"wg": 12.429, "pp": 21.739, "sr": 15.456, "secondary_structure": {"wg": {"H": 12.429, "S": 0.0, "L": 0.0}, "sr": {"H": 3.285, "S": 3.215, "L": 8.956}, "pp": {"H": 0.0, "S": 21.739, "L": 0.0}, "sg": {"H": 0.0, "S": 0.0, "L": 0.0}}, "total": 49.623999999999995, "sg": 0.0}, "nuc_id": "E.405. ", "interacts_by": ["sr", "wg", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "sr": {"sc": 9, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 1, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 16, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 1}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 9.544, "sr": 21.697, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 21.697}, "pp": {"H": 0, "S": 0, "L": 9.544}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 31.241, "sg": 0.0}, "nuc_id": "F.418. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "sr": {"sc": 2, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 1}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 4, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 0.0, "sr": 18.969, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 18.969}, "pp": {"H": 0, "S": 0, "L": 0.0}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 18.969, "sg": 0.0}, "nuc_id": "D.417. ", "interacts_by": ["sr"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 2, "basa_sum": {"wg": 10.572000000000001, "pp": 5.061, "sr": 0.0, "secondary_structure": {"wg": {"H": 1.499, "S": 0, "L": 9.073}, "sr": {"H": 0.0, "S": 0, "L": 0.0}, "pp": {"H": 0.0, "S": 0, "L": 5.061}, "sg": {"H": 0.0, "S": 0, "L": 0.0}}, "total": 15.633000000000001, "sg": 0.0}, "nuc_id": "E.407. ", "interacts_by": ["wg", "pp"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 11.139, "pp": 0.0, "sr": 0.0, "secondary_structure": {"wg": {"H": 11.139, "S": 0, "L": 0}, "sr": {"H": 0.0, "S": 0, "L": 0}, "pp": {"H": 0.0, "S": 0, "L": 0}, "sg": {"H": 0.0, "S": 0, "L": 0}}, "total": 11.139, "sg": 0.0}, "nuc_id": "F.412. ", "interacts_by": ["wg"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 1.844, "pp": 6.283, "sr": 32.156, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 1.844}, "sr": {"H": 0, "S": 0, "L": 32.156}, "pp": {"H": 0, "S": 0, "L": 6.283}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 40.283, "sg": 0.0}, "nuc_id": "F.410. ", "interacts_by": ["sr", "pp"], "interacts_with": ["sc", "mc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 11.139, "pp": 0.0, "sr": 0.0, "secondary_structure": {"wg": {"H": 11.139, "S": 0, "L": 0}, "sr": {"H": 0.0, "S": 0, "L": 0}, "pp": {"H": 0.0, "S": 0, "L": 0}, "sg": {"H": 0.0, "S": 0, "L": 0}}, "total": 11.139, "sg": 0.0}, "nuc_id": "D.412. ", "interacts_by": ["wg"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0.0, "pp": 0.0, "sr": 18.969, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0.0}, "sr": {"H": 0, "S": 0, "L": 18.969}, "pp": {"H": 0, "S": 0, "L": 0.0}, "sg": {"H": 0, "S": 0, "L": 0.0}}, "total": 18.969, "sg": 0.0}, "nuc_id": "F.417. ", "interacts_by": ["sr"], "interacts_with": ["sc"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0, "pp": 0, "sr": 0, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": 0}, "nuc_id": "E.404. ", "interacts_by": [null], "interacts_with": [null], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "residue_interaction_count": 1, "basa_sum": {"wg": 0, "pp": 0, "sr": 0, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": 0}, "nuc_id": "C.404. ", "interacts_by": [null], "interacts_with": [null], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "secondary_structure": {"wg": {"H": 0, "S": 0, "L": 0}, "sr": {"H": 0, "S": 0, "L": 0}, "pp": {"H": 0, "S": 0, "L": 0}, "sg": {"H": 0, "S": 0, "L": 0}}, "total": 0, "sg": {"sc": 0, "mc": 0}}}], "protein_chains": ["B", "H"], "pro_entity_id": "B1@H1", "sse_data": [{"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": -0.723, "s": 30.084, "rho": 12.773}, "interacting_nucleotides": ["F.410. ", "F.411. "], "basa_sum": {"sc": 44.275, "total": 46.033, "mc": 1.757}, "sse_id": "B.138. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": -0.162, "s": 51.627, "rho": 30.474}, "interacting_nucleotides": ["C.405. ", "C.404. "], "basa_sum": {"sc": 27.997, "total": 27.997, "mc": 0.0}, "sse_id": "SH11", "interacts_by": [null, "sc"], "interacts_with": [null, "sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 10, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.074, "s": 23.679, "rho": 10.793}, "interacting_nucleotides": ["E.407. ", "E.406. "], "basa_sum": {"sc": 22.667, "total": 24.935000000000002, "mc": 2.268}, "sse_id": "B.296. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 1, "mc": 1}, "bs": {"sc": 0, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.131, "s": 58.032, "rho": 10.404}, "interacting_nucleotides": ["C.406. ", "C.407. "], "basa_sum": {"sc": 22.667, "total": 24.935000000000002, "mc": 2.268}, "sse_id": "H.296. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "wg", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 1, "mc": 1}, "bs": {"sc": 0, "mc": 0}, "total": 4, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": -0.472, "s": 32.025, "rho": 11.827}, "interacting_nucleotides": ["D.419. "], "basa_sum": {"sc": 35.865, "total": 35.982, "mc": 0.118}, "sse_id": "B.139. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": -0.712, "s": 64.243, "rho": 12.066}, "interacting_nucleotides": ["D.410. ", "D.411. "], "basa_sum": {"sc": 46.777, "total": 48.534, "mc": 1.757}, "sse_id": "H.138. ", "interacts_by": ["sc", "mc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 1, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": -0.275, "s": 24.649, "rho": 10.613}, "interacting_nucleotides": ["E.406. "], "basa_sum": {"sc": 0.057, "total": 0.417, "mc": 0.36}, "sse_id": "B.297. ", "interacts_by": ["mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 4, "helicoidal_coordinates": {"phi": -0.798, "s": 54.151, "rho": 15.661}, "interacting_nucleotides": ["D.412. ", "C.406. ", "C.405. ", "C.407. "], "basa_sum": {"sc": 33.337, "total": 33.337, "mc": 0.0}, "sse_id": "HH3", "interacts_by": ["sc"], "interacts_with": ["sr", "wg"], "vdw_interaction_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.152, "s": 45.611, "rho": 13.213}, "interacting_nucleotides": ["D.417. ", "D.418. "], "basa_sum": {"sc": 43.954, "total": 43.954, "mc": 0.0}, "sse_id": "H.268. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 4, "helicoidal_coordinates": {"phi": -0.802, "s": 19.797, "rho": 16.377}, "interacting_nucleotides": ["F.412. ", "E.405. ", "E.406. ", "E.407. "], "basa_sum": {"sc": 33.337, "total": 33.337, "mc": 0.0}, "sse_id": "HB3", "interacts_by": ["sc"], "interacts_with": ["sr", "wg"], "vdw_interaction_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 2, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 0.311, "s": 53.18, "rho": 16.062}, "interacting_nucleotides": ["C.406. "], "basa_sum": {"sc": 14.549, "total": 14.549, "mc": 0.0}, "sse_id": "H.259. ", "interacts_by": ["sc"], "interacts_with": ["sr"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.106, "s": 11.257, "rho": 13.585}, "interacting_nucleotides": ["F.417. ", "F.418. "], "basa_sum": {"sc": 43.954, "total": 43.954, "mc": 0.0}, "sse_id": "B.268. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 2, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 5, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": -0.233, "s": 59.003, "rho": 10.038}, "interacting_nucleotides": ["C.406. "], "basa_sum": {"sc": 0.057, "total": 0.417, "mc": 0.36}, "sse_id": "H.297. ", "interacts_by": ["mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": -0.178, "s": 17.274, "rho": 31.011}, "interacting_nucleotides": ["E.404. ", "E.405. "], "basa_sum": {"sc": 27.997, "total": 27.997, "mc": 0.0}, "sse_id": "SB11", "interacts_by": [null, "sc"], "interacts_with": [null, "sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 7, "mc": 0}, "sr": {"sc": 3, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 10, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 0.03, "s": 55.315, "rho": 12.652}, "interacting_nucleotides": ["C.406. "], "basa_sum": {"sc": 1.709, "total": 1.709, "mc": 0.0}, "sse_id": "H.295. ", "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.233, "s": 14.945, "rho": 13.12}, "interacting_nucleotides": ["E.405. ", "E.406. "], "basa_sum": {"sc": 19.855, "total": 20.003, "mc": 0.148}, "sse_id": "B.261. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 6, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 2, "helicoidal_coordinates": {"phi": 0.283, "s": 49.298, "rho": 12.83}, "interacting_nucleotides": ["C.405. ", "C.406. "], "basa_sum": {"sc": 19.855, "total": 20.003, "mc": 0.148}, "sse_id": "H.261. ", "interacts_by": ["sc"], "interacts_with": ["sr", "pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 6, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 6, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 1, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": 0.269, "s": 18.827, "rho": 16.33}, "interacting_nucleotides": ["E.406. "], "basa_sum": {"sc": 14.549, "total": 14.549, "mc": 0.0}, "sse_id": "B.259. ", "interacts_by": ["sc"], "interacts_with": ["sr"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}, {"nucleotide_interaction_count": 1, "helicoidal_coordinates": {"phi": -0.014, "s": 20.961, "rho": 13.096}, "interacting_nucleotides": ["E.406. "], "basa_sum": {"sc": 1.709, "total": 1.709, "mc": 0.0}, "sse_id": "B.295. ", "interacts_by": ["sc", "mc"], "interacts_with": ["pp"], "vdw_interaction_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 1, "mc": 1}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 2, "sg": {"sc": 0, "mc": 0}}, "hbond_sum": {"wg": {"sc": 0, "mc": 0}, "pp": {"sc": 0, "mc": 0}, "sr": {"sc": 0, "mc": 0}, "bs": {"sc": 0, "mc": 0}, "total": 0, "sg": {"sc": 0, "mc": 0}}}]}]]}, "meta_data": {"added_heavy_atoms": [], "cath": {"Homology": ["2.60.40.720"], "Class": ["2"], "Architecture": ["2.60"], "Topology": ["2.60.40"]}, "citation_data": {"doi": "?", "structure_title": "Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element", "authors": ["Ethayathulla, A.S.", "Viadiu, H."], "release_data": "2013-01-16", "exp_method": "X-RAY DIFFRACTION", "citation_title": "Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element", "pubmed_id": "?", "year": 2013, "keywords": "BETA-IMMUNOGLOBULIN FOLD, TUMOR SUPPRESSOR, DNA BINDING PROTEIN-DNA complex"}, "processing_options": {"run_pdb2pqr": true, "include_annotations": false, "clean_structure": true, "ensemble_analysis": true}, "deleted_models": [], "removed_residues": [], "program_versions": {"msms": "2.6.1", "reduce": "3.24.130724", "curves": "5.3", "hbplus": "3.2", "x3dna-snap": "beta-r10-2017apr10", "pdb2pqr": "2.1.1", "x3dna": "2.3", "dssr": "1.6.9", "dssp": "2.0.4"}, "processed_date": "2024-05-31", "modified_ids": [], "assembly_chains": {"A": "A", "C": "E", "B": "B", "E": "E", "D": "F", "G": "A", "F": "F", "H": "B"}, "ensemble": false}, "protein": {"models": [{"entities": [{"number_of_residues": 396, "segments": ["A1", "G1"], "residue_ids": ["A.113. ", "A.114. ", "A.115. ", "A.116. ", "A.117. ", "A.118. ", "A.119. ", "A.120. ", "A.121. ", "A.122. ", "A.123. ", "A.124. ", "A.125. ", "A.126. ", "A.127. ", "A.128. ", "A.129. ", "A.130. ", "A.131. ", "A.132. ", "A.133. ", "A.134. ", "A.135. ", "A.136. ", "A.137. ", "A.138. ", "A.139. ", "A.140. ", "A.141. ", "A.142. ", "A.143. ", "A.144. ", "A.145. ", "A.146. ", "A.147. ", "A.148. ", "A.149. ", "A.150. ", "A.151. ", "A.152. ", "A.153. ", "A.154. ", "A.155. ", "A.156. ", "A.157. ", "A.158. ", "A.159. ", "A.160. ", "A.161. ", "A.162. ", "A.163. ", "A.164. ", "A.165. ", "A.166. ", "A.167. ", "A.168. ", "A.169. ", "A.170. ", "A.171. ", "A.172. ", "A.173. ", "A.174. ", "A.175. ", "A.176. ", "A.177. ", "A.178. ", "A.179. ", "A.180. ", "A.181. ", "A.182. ", "A.183. ", "A.184. ", "A.185. ", "A.186. ", "A.187. ", "A.188. ", "A.189. ", "A.190. ", "A.191. ", "A.192. ", "A.193. ", "A.194. ", "A.195. ", "A.196. ", "A.197. ", "A.198. ", "A.199. ", "A.200. ", "A.201. ", "A.202. ", "A.203. ", "A.204. ", "A.205. ", "A.206. ", "A.207. ", "A.208. ", "A.209. ", "A.210. ", "A.211. ", "A.212. ", "A.213. ", "A.214. ", "A.215. ", "A.216. ", "A.217. ", "A.218. ", "A.219. ", "A.220. ", "A.221. ", "A.222. ", "A.223. ", "A.224. ", "A.225. ", "A.226. ", "A.227. ", "A.228. ", "A.229. ", "A.230. ", "A.231. ", "A.232. ", "A.233. ", "A.234. ", "A.235. ", "A.236. ", "A.237. ", "A.238. ", "A.239. ", "A.240. ", "A.241. ", "A.242. ", "A.243. ", "A.244. ", "A.245. ", "A.246. ", "A.247. ", "A.248. ", "A.249. ", "A.250. ", "A.251. ", "A.252. ", "A.253. ", "A.254. ", "A.255. ", "A.256. ", "A.257. ", "A.258. ", "A.259. ", "A.260. ", "A.261. ", "A.262. ", "A.263. ", "A.264. ", "A.265. ", "A.266. ", "A.267. ", "A.268. ", "A.269. ", "A.270. ", "A.271. ", "A.272. ", "A.273. ", "A.274. ", "A.275. ", "A.276. ", "A.277. ", "A.278. ", "A.279. ", "A.280. ", "A.281. ", "A.282. ", "A.283. ", "A.284. ", "A.285. ", "A.286. ", "A.287. ", "A.288. ", "A.289. ", "A.290. ", "A.291. ", "A.292. ", "A.293. ", "A.294. ", "A.295. ", "A.296. ", "A.297. ", "A.298. ", "A.299. ", "A.300. ", "A.301. ", "A.302. ", "A.303. ", "A.304. ", "A.305. ", "A.306. ", "A.307. ", "A.308. ", "A.309. ", "A.310. ", "G.113. ", "G.114. ", "G.115. ", "G.116. ", "G.117. ", "G.118. ", "G.119. ", "G.120. ", "G.121. ", "G.122. ", "G.123. ", "G.124. ", "G.125. ", "G.126. ", "G.127. ", "G.128. ", "G.129. ", "G.130. ", "G.131. ", "G.132. ", "G.133. ", "G.134. ", "G.135. ", "G.136. ", "G.137. ", "G.138. ", "G.139. ", "G.140. ", "G.141. ", "G.142. ", "G.143. ", "G.144. ", "G.145. ", "G.146. ", "G.147. ", "G.148. ", "G.149. ", "G.150. ", "G.151. ", "G.152. ", "G.153. ", "G.154. ", "G.155. ", "G.156. ", "G.157. ", "G.158. ", "G.159. ", "G.160. ", "G.161. ", "G.162. ", "G.163. ", "G.164. ", "G.165. ", "G.166. ", "G.167. ", "G.168. ", "G.169. ", "G.170. ", "G.171. ", "G.172. ", "G.173. ", "G.174. ", "G.175. ", "G.176. ", "G.177. ", "G.178. ", "G.179. ", "G.180. ", "G.181. ", "G.182. ", "G.183. ", "G.184. ", "G.185. ", "G.186. ", "G.187. ", "G.188. ", "G.189. ", "G.190. ", "G.191. ", "G.192. ", "G.193. ", "G.194. ", "G.195. ", "G.196. ", "G.197. ", "G.198. ", "G.199. ", "G.200. ", "G.201. ", "G.202. ", "G.203. ", "G.204. ", "G.205. ", "G.206. ", "G.207. ", "G.208. ", "G.209. ", "G.210. ", "G.211. ", "G.212. ", "G.213. ", "G.214. ", "G.215. ", "G.216. ", "G.217. ", "G.218. ", "G.219. ", "G.220. ", "G.221. ", "G.222. ", "G.223. ", "G.224. ", "G.225. ", "G.226. ", "G.227. ", "G.228. ", "G.229. ", "G.230. ", "G.231. ", "G.232. ", "G.233. ", "G.234. ", "G.235. ", "G.236. ", "G.237. ", "G.238. ", "G.239. ", "G.240. ", "G.241. ", "G.242. ", "G.243. ", "G.244. ", "G.245. ", "G.246. ", "G.247. ", "G.248. ", "G.249. ", "G.250. ", "G.251. ", "G.252. ", "G.253. ", "G.254. ", "G.255. ", "G.256. ", "G.257. ", "G.258. ", "G.259. ", "G.260. ", "G.261. ", "G.262. ", "G.263. ", "G.264. ", "G.265. ", "G.266. ", "G.267. ", "G.268. ", "G.269. ", "G.270. ", "G.271. ", "G.272. ", "G.273. ", "G.274. ", "G.275. ", "G.276. ", "G.277. ", "G.278. ", "G.279. ", "G.280. ", "G.281. ", "G.282. ", "G.283. ", "G.284. ", "G.285. ", "G.286. ", "G.287. ", "G.288. ", "G.289. ", "G.290. ", "G.291. ", "G.292. ", "G.293. ", "G.294. ", "G.295. ", "G.296. ", "G.297. ", "G.298. ", "G.299. ", "G.300. ", "G.301. ", "G.302. ", "G.303. ", "G.304. ", "G.305. ", "G.306. ", "G.307. ", "G.308. ", "G.309. ", "G.310. "], "id": "A1@G1", "subunits": 2}, {"number_of_residues": 396, "segments": ["B1", "H1"], "residue_ids": ["B.113. ", "B.114. ", "B.115. ", "B.116. ", "B.117. ", "B.118. ", "B.119. ", "B.120. ", "B.121. ", "B.122. ", "B.123. ", "B.124. ", "B.125. ", "B.126. ", "B.127. ", "B.128. ", "B.129. ", "B.130. ", "B.131. ", "B.132. ", "B.133. ", "B.134. ", "B.135. ", "B.136. ", "B.137. ", "B.138. ", "B.139. ", "B.140. ", "B.141. ", "B.142. ", "B.143. ", "B.144. ", "B.145. ", "B.146. ", "B.147. ", "B.148. ", "B.149. ", "B.150. ", "B.151. ", "B.152. ", "B.153. ", "B.154. ", "B.155. ", "B.156. ", "B.157. ", "B.158. ", "B.159. ", "B.160. ", "B.161. ", "B.162. ", "B.163. ", "B.164. ", "B.165. ", "B.166. ", "B.167. ", "B.168. ", "B.169. ", "B.170. ", "B.171. ", "B.172. ", "B.173. ", "B.174. ", "B.175. ", "B.176. ", "B.177. ", "B.178. ", "B.179. ", "B.180. ", "B.181. ", "B.182. ", "B.183. ", "B.184. ", "B.185. ", "B.186. ", "B.187. ", "B.188. ", "B.189. ", "B.190. ", "B.191. ", "B.192. ", "B.193. ", "B.194. ", "B.195. ", "B.196. ", "B.197. ", "B.198. ", "B.199. ", "B.200. ", "B.201. ", "B.202. ", "B.203. ", "B.204. ", "B.205. ", "B.206. ", "B.207. ", "B.208. ", "B.209. ", "B.210. ", "B.211. ", "B.212. ", "B.213. ", "B.214. ", "B.215. ", "B.216. ", "B.217. ", "B.218. ", "B.219. ", "B.220. ", "B.221. ", "B.222. ", "B.223. ", "B.224. ", "B.225. ", "B.226. ", "B.227. ", "B.228. ", "B.229. ", "B.230. ", "B.231. ", "B.232. ", "B.233. ", "B.234. ", "B.235. ", "B.236. ", "B.237. ", "B.238. ", "B.239. ", "B.240. ", "B.241. ", "B.242. ", "B.243. ", "B.244. ", "B.245. ", "B.246. ", "B.247. ", "B.248. ", "B.249. ", "B.250. ", "B.251. ", "B.252. ", "B.253. ", "B.254. ", "B.255. ", "B.256. ", "B.257. ", "B.258. ", "B.259. ", "B.260. ", "B.261. ", "B.262. ", "B.263. ", "B.264. ", "B.265. ", "B.266. ", "B.267. ", "B.268. ", "B.269. ", "B.270. ", "B.271. ", "B.272. ", "B.273. ", "B.274. ", "B.275. ", "B.276. ", "B.277. ", "B.278. ", "B.279. ", "B.280. ", "B.281. ", "B.282. ", "B.283. ", "B.284. ", "B.285. ", "B.286. ", "B.287. ", "B.288. ", "B.289. ", "B.290. ", "B.291. ", "B.292. ", "B.293. ", "B.294. ", "B.295. ", "B.296. ", "B.297. ", "B.298. ", "B.299. ", "B.300. ", "B.301. ", "B.302. ", "B.303. ", "B.304. ", "B.305. ", "B.306. ", "B.307. ", "B.308. ", "B.309. ", "B.310. ", "H.113. ", "H.114. ", "H.115. ", "H.116. ", "H.117. ", "H.118. ", "H.119. ", "H.120. ", "H.121. ", "H.122. ", "H.123. ", "H.124. ", "H.125. ", "H.126. ", "H.127. ", "H.128. ", "H.129. ", "H.130. ", "H.131. ", "H.132. ", "H.133. ", "H.134. ", "H.135. ", "H.136. ", "H.137. ", "H.138. ", "H.139. ", "H.140. ", "H.141. ", "H.142. ", "H.143. ", "H.144. ", "H.145. ", "H.146. ", "H.147. ", "H.148. ", "H.149. ", "H.150. ", "H.151. ", "H.152. ", "H.153. ", "H.154. ", "H.155. ", "H.156. ", "H.157. ", "H.158. ", "H.159. ", "H.160. ", "H.161. ", "H.162. ", "H.163. ", "H.164. ", "H.165. ", "H.166. ", "H.167. ", "H.168. ", "H.169. ", "H.170. ", "H.171. ", "H.172. ", "H.173. ", "H.174. ", "H.175. ", "H.176. ", "H.177. ", "H.178. ", "H.179. ", "H.180. ", "H.181. ", "H.182. ", "H.183. ", "H.184. ", "H.185. ", "H.186. ", "H.187. ", "H.188. ", "H.189. ", "H.190. ", "H.191. ", "H.192. ", "H.193. ", "H.194. ", "H.195. ", "H.196. ", "H.197. ", "H.198. ", "H.199. ", "H.200. ", "H.201. ", "H.202. ", "H.203. ", "H.204. ", "H.205. ", "H.206. ", "H.207. ", "H.208. ", "H.209. ", "H.210. ", "H.211. ", "H.212. ", "H.213. ", "H.214. ", "H.215. ", "H.216. ", "H.217. ", "H.218. ", "H.219. ", "H.220. ", "H.221. ", "H.222. ", "H.223. ", "H.224. ", "H.225. ", "H.226. ", "H.227. ", "H.228. ", "H.229. ", "H.230. ", "H.231. ", "H.232. ", "H.233. ", "H.234. ", "H.235. ", "H.236. ", "H.237. ", "H.238. ", "H.239. ", "H.240. ", "H.241. ", "H.242. ", "H.243. ", "H.244. ", "H.245. ", "H.246. ", "H.247. ", "H.248. ", "H.249. ", "H.250. ", "H.251. ", "H.252. ", "H.253. ", "H.254. ", "H.255. ", "H.256. ", "H.257. ", "H.258. ", "H.259. ", "H.260. ", "H.261. ", "H.262. ", "H.263. ", "H.264. ", "H.265. ", "H.266. ", "H.267. ", "H.268. ", "H.269. ", "H.270. ", "H.271. ", "H.272. ", "H.273. ", "H.274. ", "H.275. ", "H.276. ", "H.277. ", "H.278. ", "H.279. ", "H.280. ", "H.281. ", "H.282. ", "H.283. ", "H.284. ", "H.285. ", "H.286. ", "H.287. ", "H.288. ", "H.289. ", "H.290. ", "H.291. ", "H.292. ", "H.293. ", "H.294. ", "H.295. ", "H.296. ", "H.297. ", "H.298. ", "H.299. ", "H.300. ", "H.301. ", "H.302. ", "H.303. ", "H.304. ", "H.305. ", "H.306. ", "H.307. ", "H.308. ", "H.309. ", "H.310. "], "id": "B1@H1", "subunits": 2}], "segments": [{"chain": "A", "sequence": "EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR", "length": 198, "secondary_structure": "LLLLLLLLLLLLLLLSSSLLLLLLLLLLLSSSSLLLLSSSSLLLLLSSSSSSLLLLLLLLLSSSSSSSSLLHHHLLLLLLLLHHHHHLLLLLLLLLLLLLLLSSSSLLLLLSSSSLLLLLLSSSSSSLLLLLLLLLLLSSSSSSLLLLLLLLLLLLLLSSSSSSSSLLLLLSSSSSSSSSSSLLLHHHHHHHHHHHHL", "residue_ids": ["A.113. ", "A.114. ", "A.115. ", "A.116. ", "A.117. ", "A.118. ", "A.119. ", "A.120. ", "A.121. ", "A.122. ", "A.123. ", "A.124. ", "A.125. ", "A.126. ", "A.127. ", "A.128. ", "A.129. ", "A.130. ", "A.131. ", "A.132. ", "A.133. ", "A.134. ", "A.135. ", "A.136. ", "A.137. ", "A.138. ", "A.139. ", "A.140. ", "A.141. ", "A.142. ", "A.143. ", "A.144. ", "A.145. ", "A.146. ", "A.147. ", "A.148. ", "A.149. ", "A.150. ", "A.151. ", "A.152. ", "A.153. ", "A.154. ", "A.155. ", "A.156. ", "A.157. ", "A.158. ", "A.159. ", "A.160. ", "A.161. ", "A.162. ", "A.163. ", "A.164. ", "A.165. ", "A.166. ", "A.167. ", "A.168. ", "A.169. ", "A.170. ", "A.171. ", "A.172. ", "A.173. ", "A.174. ", "A.175. ", "A.176. ", "A.177. ", "A.178. ", "A.179. ", "A.180. ", "A.181. ", "A.182. ", "A.183. ", "A.184. ", "A.185. ", "A.186. ", "A.187. ", "A.188. ", "A.189. ", "A.190. ", "A.191. ", "A.192. ", "A.193. ", "A.194. ", "A.195. ", "A.196. ", "A.197. ", "A.198. ", "A.199. ", "A.200. ", "A.201. ", "A.202. ", "A.203. ", "A.204. ", "A.205. ", "A.206. ", "A.207. ", "A.208. ", "A.209. ", "A.210. ", "A.211. ", "A.212. ", "A.213. ", "A.214. ", "A.215. ", "A.216. ", "A.217. ", "A.218. ", "A.219. ", "A.220. ", "A.221. ", "A.222. ", "A.223. ", "A.224. ", "A.225. ", "A.226. ", "A.227. ", "A.228. ", "A.229. ", "A.230. ", "A.231. ", "A.232. ", "A.233. ", "A.234. ", "A.235. ", "A.236. ", "A.237. ", "A.238. ", "A.239. ", "A.240. ", "A.241. ", "A.242. ", "A.243. ", "A.244. ", "A.245. ", "A.246. ", "A.247. ", "A.248. ", "A.249. ", "A.250. ", "A.251. ", "A.252. ", "A.253. ", "A.254. ", "A.255. ", "A.256. ", "A.257. ", "A.258. ", "A.259. ", "A.260. ", "A.261. ", "A.262. ", "A.263. ", "A.264. ", "A.265. ", "A.266. ", "A.267. ", "A.268. ", "A.269. ", "A.270. ", "A.271. ", "A.272. ", "A.273. ", "A.274. ", "A.275. ", "A.276. ", "A.277. ", "A.278. ", "A.279. ", "A.280. ", "A.281. ", "A.282. ", "A.283. ", "A.284. ", "A.285. ", "A.286. ", "A.287. ", "A.288. ", "A.289. ", "A.290. ", "A.291. ", "A.292. ", "A.293. ", "A.294. ", "A.295. ", "A.296. ", "A.297. ", "A.298. ", "A.299. ", "A.300. ", "A.301. ", "A.302. ", "A.303. ", "A.304. ", "A.305. ", "A.306. ", "A.307. ", "A.308. ", "A.309. ", "A.310. "], "id": "A1"}, {"chain": "B", "sequence": "EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR", "length": 198, "secondary_structure": "LLLLLLLLLLLLLLLSSSLLLLLLLLLLLSSSSLLLLSSSSLLLLSSSSSSSLLLLLLLLLSSSSSSSSLLHHHLLLLLLLLHHHHLLLLLLLLLLLLLLLLSSSLLLLLLSSSSLLLLLLSSSSSSLLLLLLLLLLLSSSSSSLLLLLLLLLLLLLLSSSSSSSSLLLLLSSSSSSSSSSSLLLHHHHHHHHHHHHL", "residue_ids": ["B.113. ", "B.114. ", "B.115. ", "B.116. ", "B.117. ", "B.118. ", "B.119. ", "B.120. ", "B.121. ", "B.122. ", "B.123. ", "B.124. ", "B.125. ", "B.126. ", "B.127. ", "B.128. ", "B.129. ", "B.130. ", "B.131. ", "B.132. ", "B.133. ", "B.134. ", "B.135. ", "B.136. ", "B.137. ", "B.138. ", "B.139. ", "B.140. ", "B.141. ", "B.142. ", "B.143. ", "B.144. ", "B.145. ", "B.146. ", "B.147. ", "B.148. ", "B.149. ", "B.150. ", "B.151. ", "B.152. ", "B.153. ", "B.154. ", "B.155. ", "B.156. ", "B.157. ", "B.158. ", "B.159. ", "B.160. ", "B.161. ", "B.162. ", "B.163. ", "B.164. ", "B.165. ", "B.166. ", "B.167. ", "B.168. ", "B.169. ", "B.170. ", "B.171. ", "B.172. ", "B.173. ", "B.174. ", "B.175. ", "B.176. ", "B.177. ", "B.178. ", "B.179. ", "B.180. ", "B.181. ", "B.182. ", "B.183. ", "B.184. ", "B.185. ", "B.186. ", "B.187. ", "B.188. ", "B.189. ", "B.190. ", "B.191. ", "B.192. ", "B.193. ", "B.194. ", "B.195. ", "B.196. ", "B.197. ", "B.198. ", "B.199. ", "B.200. ", "B.201. ", "B.202. ", "B.203. ", "B.204. ", "B.205. ", "B.206. ", "B.207. ", "B.208. ", "B.209. ", "B.210. ", "B.211. ", "B.212. ", "B.213. ", "B.214. ", "B.215. ", "B.216. ", "B.217. ", "B.218. ", "B.219. ", "B.220. ", "B.221. ", "B.222. ", "B.223. ", "B.224. ", "B.225. ", "B.226. ", "B.227. ", "B.228. ", "B.229. ", "B.230. ", "B.231. ", "B.232. ", "B.233. ", "B.234. ", "B.235. ", "B.236. ", "B.237. ", "B.238. ", "B.239. ", "B.240. ", "B.241. ", "B.242. ", "B.243. ", "B.244. ", "B.245. ", "B.246. ", "B.247. ", "B.248. ", "B.249. ", "B.250. ", "B.251. ", "B.252. ", "B.253. ", "B.254. ", "B.255. ", "B.256. ", "B.257. ", "B.258. ", "B.259. ", "B.260. ", "B.261. ", "B.262. ", "B.263. ", "B.264. ", "B.265. ", "B.266. ", "B.267. ", "B.268. ", "B.269. ", "B.270. ", "B.271. ", "B.272. ", "B.273. ", "B.274. ", "B.275. ", "B.276. ", "B.277. ", "B.278. ", "B.279. ", "B.280. ", "B.281. ", "B.282. ", "B.283. ", "B.284. ", "B.285. ", "B.286. ", "B.287. ", "B.288. ", "B.289. ", "B.290. ", "B.291. ", "B.292. ", "B.293. ", "B.294. ", "B.295. ", "B.296. ", "B.297. ", "B.298. ", "B.299. ", "B.300. ", "B.301. ", "B.302. ", "B.303. ", "B.304. ", "B.305. ", "B.306. ", "B.307. ", "B.308. ", "B.309. ", "B.310. "], "id": "B1"}, {"chain": "G", "sequence": "EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR", "length": 198, "secondary_structure": "LLLLLLLLLLLLLLLSSSLLLLLLLLLLLSSSSLLLLSSSSLLLLLSSSSSSLLLLLLLLLSSSSSSSSLLHHHLLLLLLLLHHHHHLLLLLLLLLLLLLLLSSSSLLLLLSSSSLLLLLLSSSSSSLLLLLLLLLLLSSSSSSLLLLLLLLLLLLLLSSSSSSSSLLLLLSSSSSSSSSSSLLLHHHHHHHHHHHHL", "residue_ids": ["G.113. ", "G.114. ", "G.115. ", "G.116. ", "G.117. ", "G.118. ", "G.119. ", "G.120. ", "G.121. ", "G.122. ", "G.123. ", "G.124. ", "G.125. ", "G.126. ", "G.127. ", "G.128. ", "G.129. ", "G.130. ", "G.131. ", "G.132. ", "G.133. ", "G.134. ", "G.135. ", "G.136. ", "G.137. ", "G.138. ", "G.139. ", "G.140. ", "G.141. ", "G.142. ", "G.143. ", "G.144. ", "G.145. ", "G.146. ", "G.147. ", "G.148. ", "G.149. ", "G.150. ", "G.151. ", "G.152. ", "G.153. ", "G.154. ", "G.155. ", "G.156. ", "G.157. ", "G.158. ", "G.159. ", "G.160. ", "G.161. ", "G.162. ", "G.163. ", "G.164. ", "G.165. ", "G.166. ", "G.167. ", "G.168. ", "G.169. ", "G.170. ", "G.171. ", "G.172. ", "G.173. ", "G.174. ", "G.175. ", "G.176. ", "G.177. ", "G.178. ", "G.179. ", "G.180. ", "G.181. ", "G.182. ", "G.183. ", "G.184. ", "G.185. ", "G.186. ", "G.187. ", "G.188. ", "G.189. ", "G.190. ", "G.191. ", "G.192. ", "G.193. ", "G.194. ", "G.195. ", "G.196. ", "G.197. ", "G.198. ", "G.199. ", "G.200. ", "G.201. ", "G.202. ", "G.203. ", "G.204. ", "G.205. ", "G.206. ", "G.207. ", "G.208. ", "G.209. ", "G.210. ", "G.211. ", "G.212. ", "G.213. ", "G.214. ", "G.215. ", "G.216. ", "G.217. ", "G.218. ", "G.219. ", "G.220. ", "G.221. ", "G.222. ", "G.223. ", "G.224. ", "G.225. ", "G.226. ", "G.227. ", "G.228. ", "G.229. ", "G.230. ", "G.231. ", "G.232. ", "G.233. ", "G.234. ", "G.235. ", "G.236. ", "G.237. ", "G.238. ", "G.239. ", "G.240. ", "G.241. ", "G.242. ", "G.243. ", "G.244. ", "G.245. ", "G.246. ", "G.247. ", "G.248. ", "G.249. ", "G.250. ", "G.251. ", "G.252. ", "G.253. ", "G.254. ", "G.255. ", "G.256. ", "G.257. ", "G.258. ", "G.259. ", "G.260. ", "G.261. ", "G.262. ", "G.263. ", "G.264. ", "G.265. ", "G.266. ", "G.267. ", "G.268. ", "G.269. ", "G.270. ", "G.271. ", "G.272. ", "G.273. ", "G.274. ", "G.275. ", "G.276. ", "G.277. ", "G.278. ", "G.279. ", "G.280. ", "G.281. ", "G.282. ", "G.283. ", "G.284. ", "G.285. ", "G.286. ", "G.287. ", "G.288. ", "G.289. ", "G.290. ", "G.291. ", "G.292. ", "G.293. ", "G.294. ", "G.295. ", "G.296. ", "G.297. ", "G.298. ", "G.299. ", "G.300. ", "G.301. ", "G.302. ", "G.303. ", "G.304. ", "G.305. ", "G.306. ", "G.307. ", "G.308. ", "G.309. ", "G.310. "], "id": "G1"}, {"chain": "H", "sequence": "EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR", "length": 198, "secondary_structure": "LLLLLLLLLLLLLLLSSSLLLLLLLLLLLSSSSLLLLSSSSLLLLSSSSSSSLLLLLLLLLSSSSSSSSLLHHHLLLLLLLLHHHHLLLLLLLLLLLLLLLLSSSLLLLLLSSSSLLLLLLSSSSSSLLLLLLLLLLLSSSSSSLLLLLLLLLLLLLLSSSSSSSSLLLLLSSSSSSSSSSSLLLHHHHHHHHHHHHL", "residue_ids": ["H.113. ", "H.114. ", "H.115. ", "H.116. ", "H.117. ", "H.118. ", "H.119. ", "H.120. ", "H.121. ", "H.122. ", "H.123. ", "H.124. ", "H.125. ", "H.126. ", "H.127. ", "H.128. ", "H.129. ", "H.130. ", "H.131. ", "H.132. ", "H.133. ", "H.134. ", "H.135. ", "H.136. ", "H.137. ", "H.138. ", "H.139. ", "H.140. ", "H.141. ", "H.142. ", "H.143. ", "H.144. ", "H.145. ", "H.146. ", "H.147. ", "H.148. ", "H.149. ", "H.150. ", "H.151. ", "H.152. ", "H.153. ", "H.154. ", "H.155. ", "H.156. ", "H.157. ", "H.158. ", "H.159. ", "H.160. ", "H.161. ", "H.162. ", "H.163. ", "H.164. ", "H.165. ", "H.166. ", "H.167. ", "H.168. ", "H.169. ", "H.170. ", "H.171. ", "H.172. ", "H.173. ", "H.174. ", "H.175. ", "H.176. ", "H.177. ", "H.178. ", "H.179. ", "H.180. ", "H.181. ", "H.182. ", "H.183. ", "H.184. ", "H.185. ", "H.186. ", "H.187. ", "H.188. ", "H.189. ", "H.190. ", "H.191. ", "H.192. ", "H.193. ", "H.194. ", "H.195. ", "H.196. ", "H.197. ", "H.198. ", "H.199. ", "H.200. ", "H.201. ", "H.202. ", "H.203. ", "H.204. ", "H.205. ", "H.206. ", "H.207. ", "H.208. ", "H.209. ", "H.210. ", "H.211. ", "H.212. ", "H.213. ", "H.214. ", "H.215. ", "H.216. ", "H.217. ", "H.218. ", "H.219. ", "H.220. ", "H.221. ", "H.222. ", "H.223. ", "H.224. ", "H.225. ", "H.226. ", "H.227. ", "H.228. ", "H.229. ", "H.230. ", "H.231. ", "H.232. ", "H.233. ", "H.234. ", "H.235. ", "H.236. ", "H.237. ", "H.238. ", "H.239. ", "H.240. ", "H.241. ", "H.242. ", "H.243. ", "H.244. ", "H.245. ", "H.246. ", "H.247. ", "H.248. ", "H.249. ", "H.250. ", "H.251. ", "H.252. ", "H.253. ", "H.254. ", "H.255. ", "H.256. ", "H.257. ", "H.258. ", "H.259. ", "H.260. ", "H.261. ", "H.262. ", "H.263. ", "H.264. ", "H.265. ", "H.266. ", "H.267. ", "H.268. ", "H.269. ", "H.270. ", "H.271. ", "H.272. ", "H.273. ", "H.274. ", "H.275. ", "H.276. ", "H.277. ", "H.278. ", "H.279. ", "H.280. ", "H.281. ", "H.282. ", "H.283. ", "H.284. ", "H.285. ", "H.286. ", "H.287. ", "H.288. ", "H.289. ", "H.290. ", "H.291. ", "H.292. ", "H.293. ", "H.294. ", "H.295. ", "H.296. ", "H.297. ", "H.298. ", "H.299. ", "H.300. ", "H.301. ", "H.302. ", "H.303. ", "H.304. ", "H.305. ", "H.306. ", "H.307. ", "H.308. ", "H.309. ", "H.310. "], "id": "H1"}], "secondary_structure_elements": [{"chain": "A", "sequence": "K", "number": 23, "secondary_structure": "L", "residue_ids": ["A.138. "], "id": "A.138. "}, {"chain": "A", "sequence": "S", "number": 24, "secondary_structure": "L", "residue_ids": ["A.139. "], "id": "A.139. "}, {"chain": "A", "sequence": "S", "number": 96, "secondary_structure": "L", "residue_ids": ["A.261. "], "id": "A.261. "}, {"chain": "A", "sequence": "R", "number": 103, "secondary_structure": "L", "residue_ids": ["A.268. "], "id": "A.268. "}, {"chain": "A", "sequence": "VLGRRSFEGRI", "number": 11, "secondary_structure": "S", "residue_ids": ["A.284. ", "A.285. ", "A.286. ", "A.287. ", "A.288. ", "A.289. ", "A.290. ", "A.291. ", "A.292. ", "A.293. ", "A.294. "], "id": "SA11"}, {"chain": "A", "sequence": "C", "number": 111, "secondary_structure": "L", "residue_ids": ["A.295. "], "id": "A.295. "}, {"chain": "A", "sequence": "A", "number": 112, "secondary_structure": "L", "residue_ids": ["A.296. "], "id": "A.296. "}, {"chain": "A", "sequence": "C", "number": 113, "secondary_structure": "L", "residue_ids": ["A.297. "], "id": "A.297. "}, {"chain": "A", "sequence": "PGRDRKADEDHY", "number": 3, "secondary_structure": "H", "residue_ids": ["A.298. ", "A.299. ", "A.300. ", "A.301. ", "A.302. ", "A.303. ", "A.304. ", "A.305. ", "A.306. ", "A.307. ", "A.308. ", "A.309. "], "id": "HA3"}, {"chain": "B", "sequence": "K", "number": 23, "secondary_structure": "L", "residue_ids": ["B.138. "], "id": "B.138. "}, {"chain": "B", "sequence": "S", "number": 24, "secondary_structure": "L", "residue_ids": ["B.139. "], "id": "B.139. "}, {"chain": "B", "sequence": "N", "number": 95, "secondary_structure": "L", "residue_ids": ["B.259. "], "id": "B.259. "}, {"chain": "B", "sequence": "S", "number": 97, "secondary_structure": "L", "residue_ids": ["B.261. "], "id": "B.261. "}, {"chain": "B", "sequence": "R", "number": 104, "secondary_structure": "L", "residue_ids": ["B.268. "], "id": "B.268. "}, {"chain": "B", "sequence": "VLGRRSFEGRI", "number": 11, "secondary_structure": "S", "residue_ids": ["B.284. ", "B.285. ", "B.286. ", "B.287. ", "B.288. ", "B.289. ", "B.290. ", "B.291. ", "B.292. ", "B.293. ", "B.294. "], "id": "SB11"}, {"chain": "B", "sequence": "C", "number": 112, "secondary_structure": "L", "residue_ids": ["B.295. "], "id": "B.295. "}, {"chain": "B", "sequence": "A", "number": 113, "secondary_structure": "L", "residue_ids": ["B.296. "], "id": "B.296. "}, {"chain": "B", "sequence": "C", "number": 114, "secondary_structure": "L", "residue_ids": ["B.297. "], "id": "B.297. "}, {"chain": "B", "sequence": "PGRDRKADEDHY", "number": 3, "secondary_structure": "H", "residue_ids": ["B.298. ", "B.299. ", "B.300. ", "B.301. ", "B.302. ", "B.303. ", "B.304. ", "B.305. ", "B.306. ", "B.307. ", "B.308. ", "B.309. "], "id": "HB3"}, {"chain": "G", "sequence": "K", "number": 23, "secondary_structure": "L", "residue_ids": ["G.138. "], "id": "G.138. "}, {"chain": "G", "sequence": "S", "number": 24, "secondary_structure": "L", "residue_ids": ["G.139. "], "id": "G.139. "}, {"chain": "G", "sequence": "S", "number": 96, "secondary_structure": "L", "residue_ids": ["G.261. "], "id": "G.261. "}, {"chain": "G", "sequence": "R", "number": 103, "secondary_structure": "L", "residue_ids": ["G.268. "], "id": "G.268. "}, {"chain": "G", "sequence": "VLGRRSFEGRI", "number": 11, "secondary_structure": "S", "residue_ids": ["G.284. ", "G.285. ", "G.286. ", "G.287. ", "G.288. ", "G.289. ", "G.290. ", "G.291. ", "G.292. ", "G.293. ", "G.294. "], "id": "SG11"}, {"chain": "G", "sequence": "C", "number": 111, "secondary_structure": "L", "residue_ids": ["G.295. "], "id": "G.295. "}, {"chain": "G", "sequence": "A", "number": 112, "secondary_structure": "L", "residue_ids": ["G.296. "], "id": "G.296. "}, {"chain": "G", "sequence": "C", "number": 113, "secondary_structure": "L", "residue_ids": ["G.297. "], "id": "G.297. "}, {"chain": "G", "sequence": "PGRDRKADEDHY", "number": 3, "secondary_structure": "H", "residue_ids": ["G.298. ", "G.299. ", "G.300. ", "G.301. ", "G.302. ", "G.303. ", "G.304. ", "G.305. ", "G.306. ", "G.307. ", "G.308. ", "G.309. "], "id": "HG3"}, {"chain": "H", "sequence": "K", "number": 23, "secondary_structure": "L", "residue_ids": ["H.138. "], "id": "H.138. "}, {"chain": "H", "sequence": "N", "number": 95, "secondary_structure": "L", "residue_ids": ["H.259. "], "id": "H.259. "}, {"chain": "H", "sequence": "S", "number": 97, "secondary_structure": "L", "residue_ids": ["H.261. "], "id": "H.261. "}, {"chain": "H", "sequence": "R", "number": 104, "secondary_structure": "L", "residue_ids": ["H.268. "], "id": "H.268. "}, {"chain": "H", "sequence": "VLGRRSFEGRI", "number": 11, "secondary_structure": "S", "residue_ids": ["H.284. ", "H.285. ", "H.286. ", "H.287. ", "H.288. ", "H.289. ", "H.290. ", "H.291. ", "H.292. ", "H.293. ", "H.294. "], "id": "SH11"}, {"chain": "H", "sequence": "C", "number": 112, "secondary_structure": "L", "residue_ids": ["H.295. "], "id": "H.295. "}, {"chain": "H", "sequence": "A", "number": 113, "secondary_structure": "L", "residue_ids": ["H.296. "], "id": "H.296. "}, {"chain": "H", "sequence": "C", "number": 114, "secondary_structure": "L", "residue_ids": ["H.297. "], "id": "H.297. "}, {"chain": "H", "sequence": "PGRDRKADEDHY", "number": 3, "secondary_structure": "H", "residue_ids": ["H.298. ", "H.299. ", "H.300. ", "H.301. ", "H.302. ", "H.303. ", "H.304. ", "H.305. ", "H.306. ", "H.307. ", "H.308. ", "H.309. "], "id": "HH3"}], "header_info": {"sheet_remarks": ["SHEET    1  A1 0 GLU A 128  THR A 130  0                              ", "SHEET    2  A2 0 TRP A 142  SER A 145  0                              ", "SHEET    3  A3 0 LYS A 150  CYS A 153  0                              ", "SHEET    4  A4 0 CYS A 159  LYS A 164  0                              ", "SHEET    5  A5 0 ALA A 174  TYR A 181  0                              ", "SHEET    6  A6 0 ILE A 215  GLU A 218  0                              ", "SHEET    7  A7 0 GLN A 224  ASP A 227  0                              ", "SHEET    8  A8 0 GLN A 234  PRO A 239  0                              ", "SHEET    9  A9 0 THR A 251  PHE A 256  0                              ", "SHEET   10 A10 0 ILE A 271  GLU A 278  0                              ", "SHEET   11 A11 0 VAL A 284  ILE A 294  0                              ", "SHEET   12  B1 0 GLU B 128  THR B 130  0                              ", "SHEET   13  B2 0 TRP B 142  SER B 145  0                              ", "SHEET   14  B3 0 LYS B 150  CYS B 153  0                              ", "SHEET   15  B4 0 THR B 158  LYS B 164  0                              ", "SHEET   16  B5 0 ALA B 174  TYR B 181  0                              ", "SHEET   17  B6 0 ILE B 215  VAL B 217  0                              ", "SHEET   18  B7 0 GLN B 224  ASP B 227  0                              ", "SHEET   19  B8 0 GLN B 234  PRO B 239  0                              ", "SHEET   20  B9 0 THR B 251  PHE B 256  0                              ", "SHEET   21 B10 0 ILE B 271  GLU B 278  0                              ", "SHEET   22 B11 0 VAL B 284  ILE B 294  0                              ", "SHEET   23  G1 0 GLU G 128  THR G 130  0                              ", "SHEET   24  G2 0 TRP G 142  SER G 145  0                              ", "SHEET   25  G3 0 LYS G 150  CYS G 153  0                              ", "SHEET   26  G4 0 CYS G 159  LYS G 164  0                              ", "SHEET   27  G5 0 ALA G 174  TYR G 181  0                              ", "SHEET   28  G6 0 ILE G 215  GLU G 218  0                              ", "SHEET   29  G7 0 GLN G 224  ASP G 227  0                              ", "SHEET   30  G8 0 GLN G 234  PRO G 239  0                              ", "SHEET   31  G9 0 THR G 251  PHE G 256  0                              ", "SHEET   32 G10 0 ILE G 271  GLU G 278  0                              ", "SHEET   33 G11 0 VAL G 284  ILE G 294  0                              ", "SHEET   34  H1 0 GLU H 128  THR H 130  0                              ", "SHEET   35  H2 0 TRP H 142  SER H 145  0                              ", "SHEET   36  H3 0 LYS H 150  CYS H 153  0                              ", "SHEET   37  H4 0 THR H 158  LYS H 164  0                              ", "SHEET   38  H5 0 ALA H 174  TYR H 181  0                              ", "SHEET   39  H6 0 ILE H 215  VAL H 217  0                              ", "SHEET   40  H7 0 GLN H 224  ASP H 227  0                              ", "SHEET   41  H8 0 GLN H 234  PRO H 239  0                              ", "SHEET   42  H9 0 THR H 251  PHE H 256  0                              ", "SHEET   43 H10 0 ILE H 271  GLU H 278  0                              ", "SHEET   44 H11 0 VAL H 284  ILE H 294  0                              "], "helix_remarks": ["HELIX    1  A1 ALA A  184  HIS A  186  1                                   3", "HELIX    2  A2 PRO A  195  LEU A  199  1                                   5", "HELIX    3  A3 PRO A  298  TYR A  309  1                                  12", "HELIX    4  B1 ALA B  184  HIS B  186  1                                   3", "HELIX    5  B2 PRO B  195  GLU B  198  1                                   4", "HELIX    6  B3 PRO B  298  TYR B  309  1                                  12", "HELIX    7  G1 ALA G  184  HIS G  186  1                                   3", "HELIX    8  G2 PRO G  195  LEU G  199  1                                   5", "HELIX    9  G3 PRO G  298  TYR G  309  1                                  12", "HELIX   10  H1 ALA H  184  HIS H  186  1                                   3", "HELIX   11  H2 PRO H  195  GLU H  198  1                                   4", "HELIX   12  H3 PRO H  298  TYR H  309  1                                  12"]}}], "chains": [{"sequence_clusters": {}, "cath_architecture": null, "uniprot_accession": null, "sequence": "EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR", "GO_cellular_component": null, "continuous": [true], "cath_topology": null, "au_chain_id": "A", "uniprot_names": null, "GO_biological_process": null, "length": 198, "cath_class": null, "interacts_with_dna": [true], "GO_molecular_function": null, "cath_homologous_superfamily": null, "secondary_structure": ["LLLLLLLLLLLLLLLSSSLLLLLLLLLLLSSSSLLLLSSSSLLLLLSSSSSSLLLLLLLLLSSSSSSSSLLHHHLLLLLLLLHHHHHLLLLLLLLLLLLLLLSSSSLLLLLSSSSLLLLLLSSSSSSLLLLLLLLLLLSSSSSSLLLLLLLLLLLLLLSSSSSSSSLLLLLSSSSSSSSSSSLLLHHHHHHHHHHHHL"], "residue_ids": ["A.113. ", "A.114. ", "A.115. ", "A.116. ", "A.117. ", "A.118. ", "A.119. ", "A.120. ", "A.121. ", "A.122. ", "A.123. ", "A.124. ", "A.125. ", "A.126. ", "A.127. ", "A.128. ", "A.129. ", "A.130. ", "A.131. ", "A.132. ", "A.133. ", "A.134. ", "A.135. ", "A.136. ", "A.137. ", "A.138. ", "A.139. ", "A.140. ", "A.141. ", "A.142. ", "A.143. ", "A.144. ", "A.145. ", "A.146. ", "A.147. ", "A.148. ", "A.149. ", "A.150. ", "A.151. ", "A.152. ", "A.153. ", "A.154. ", "A.155. ", "A.156. ", "A.157. ", "A.158. ", "A.159. ", "A.160. ", "A.161. ", "A.162. ", "A.163. ", "A.164. ", "A.165. ", "A.166. ", "A.167. ", "A.168. ", "A.169. ", "A.170. ", "A.171. ", "A.172. ", "A.173. ", "A.174. ", "A.175. ", "A.176. ", "A.177. ", "A.178. ", "A.179. ", "A.180. ", "A.181. ", "A.182. ", "A.183. ", "A.184. ", "A.185. ", "A.186. ", "A.187. ", "A.188. ", "A.189. ", "A.190. ", "A.191. ", "A.192. ", "A.193. ", "A.194. ", "A.195. ", "A.196. ", "A.197. ", "A.198. ", "A.199. ", "A.200. ", "A.201. ", "A.202. ", "A.203. ", "A.204. ", "A.205. ", "A.206. ", "A.207. ", "A.208. ", "A.209. ", "A.210. ", "A.211. ", "A.212. ", "A.213. ", "A.214. ", "A.215. ", "A.216. ", "A.217. ", "A.218. ", "A.219. ", "A.220. ", "A.221. ", "A.222. ", "A.223. ", "A.224. ", "A.225. ", "A.226. ", "A.227. ", "A.228. ", "A.229. ", "A.230. ", "A.231. ", "A.232. ", "A.233. ", "A.234. ", "A.235. ", "A.236. ", "A.237. ", "A.238. ", "A.239. ", "A.240. ", "A.241. ", "A.242. ", "A.243. ", "A.244. ", "A.245. ", "A.246. ", "A.247. ", "A.248. ", "A.249. ", "A.250. ", "A.251. ", "A.252. ", "A.253. ", "A.254. ", "A.255. ", "A.256. ", "A.257. ", "A.258. ", "A.259. ", "A.260. ", "A.261. ", "A.262. ", "A.263. ", "A.264. ", "A.265. ", "A.266. ", "A.267. ", "A.268. ", "A.269. ", "A.270. ", "A.271. ", "A.272. ", "A.273. ", "A.274. ", "A.275. ", "A.276. ", "A.277. ", "A.278. ", "A.279. ", "A.280. ", "A.281. ", "A.282. ", "A.283. ", "A.284. ", "A.285. ", "A.286. ", "A.287. ", "A.288. ", "A.289. ", "A.290. ", "A.291. ", "A.292. ", "A.293. ", "A.294. ", "A.295. ", "A.296. ", "A.297. ", "A.298. ", "A.299. ", "A.300. ", "A.301. ", "A.302. ", "A.303. ", "A.304. ", "A.305. ", "A.306. ", "A.307. ", "A.308. ", "A.309. ", "A.310. "], "organism": null, "id": "A"}, {"sequence_clusters": {}, "cath_architecture": null, "uniprot_accession": null, "sequence": "EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR", "GO_cellular_component": null, "continuous": [true], "cath_topology": null, "au_chain_id": "B", "uniprot_names": null, "GO_biological_process": null, "length": 198, "cath_class": null, "interacts_with_dna": [true], "GO_molecular_function": null, "cath_homologous_superfamily": null, "secondary_structure": ["LLLLLLLLLLLLLLLSSSLLLLLLLLLLLSSSSLLLLSSSSLLLLSSSSSSSLLLLLLLLLSSSSSSSSLLHHHLLLLLLLLHHHHLLLLLLLLLLLLLLLLSSSLLLLLLSSSSLLLLLLSSSSSSLLLLLLLLLLLSSSSSSLLLLLLLLLLLLLLSSSSSSSSLLLLLSSSSSSSSSSSLLLHHHHHHHHHHHHL"], "residue_ids": ["B.113. ", "B.114. ", "B.115. ", "B.116. ", "B.117. ", "B.118. ", "B.119. ", "B.120. ", "B.121. ", "B.122. ", "B.123. ", "B.124. ", "B.125. ", "B.126. ", "B.127. ", "B.128. ", "B.129. ", "B.130. ", "B.131. ", "B.132. ", "B.133. ", "B.134. ", "B.135. ", "B.136. ", "B.137. ", "B.138. ", "B.139. ", "B.140. ", "B.141. ", "B.142. ", "B.143. ", "B.144. ", "B.145. ", "B.146. ", "B.147. ", "B.148. ", "B.149. ", "B.150. ", "B.151. ", "B.152. ", "B.153. ", "B.154. ", "B.155. ", "B.156. ", "B.157. ", "B.158. ", "B.159. ", "B.160. ", "B.161. ", "B.162. ", "B.163. ", "B.164. ", "B.165. ", "B.166. ", "B.167. ", "B.168. ", "B.169. ", "B.170. ", "B.171. ", "B.172. ", "B.173. ", "B.174. ", "B.175. ", "B.176. ", "B.177. ", "B.178. ", "B.179. ", "B.180. ", "B.181. ", "B.182. ", "B.183. ", "B.184. ", "B.185. ", "B.186. ", "B.187. ", "B.188. ", "B.189. ", "B.190. ", "B.191. ", "B.192. ", "B.193. ", "B.194. ", "B.195. ", "B.196. ", "B.197. ", "B.198. ", "B.199. ", "B.200. ", "B.201. ", "B.202. ", "B.203. ", "B.204. ", "B.205. ", "B.206. ", "B.207. ", "B.208. ", "B.209. ", "B.210. ", "B.211. ", "B.212. ", "B.213. ", "B.214. ", "B.215. ", "B.216. ", "B.217. ", "B.218. ", "B.219. ", "B.220. ", "B.221. ", "B.222. ", "B.223. ", "B.224. ", "B.225. ", "B.226. ", "B.227. ", "B.228. ", "B.229. ", "B.230. ", "B.231. ", "B.232. ", "B.233. ", "B.234. ", "B.235. ", "B.236. ", "B.237. ", "B.238. ", "B.239. ", "B.240. ", "B.241. ", "B.242. ", "B.243. ", "B.244. ", "B.245. ", "B.246. ", "B.247. ", "B.248. ", "B.249. ", "B.250. ", "B.251. ", "B.252. ", "B.253. ", "B.254. ", "B.255. ", "B.256. ", "B.257. ", "B.258. ", "B.259. ", "B.260. ", "B.261. ", "B.262. ", "B.263. ", "B.264. ", "B.265. ", "B.266. ", "B.267. ", "B.268. ", "B.269. ", "B.270. ", "B.271. ", "B.272. ", "B.273. ", "B.274. ", "B.275. ", "B.276. ", "B.277. ", "B.278. ", "B.279. ", "B.280. ", "B.281. ", "B.282. ", "B.283. ", "B.284. ", "B.285. ", "B.286. ", "B.287. ", "B.288. ", "B.289. ", "B.290. ", "B.291. ", "B.292. ", "B.293. ", "B.294. ", "B.295. ", "B.296. ", "B.297. ", "B.298. ", "B.299. ", "B.300. ", "B.301. ", "B.302. ", "B.303. ", "B.304. ", "B.305. ", "B.306. ", "B.307. ", "B.308. ", "B.309. ", "B.310. "], "organism": null, "id": "B"}, {"sequence_clusters": {}, "cath_architecture": null, "uniprot_accession": null, "sequence": "EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR", "GO_cellular_component": null, "continuous": [true], "cath_topology": null, "au_chain_id": "A", "uniprot_names": null, "GO_biological_process": null, "length": 198, "cath_class": null, "interacts_with_dna": [true], "GO_molecular_function": null, "cath_homologous_superfamily": null, "secondary_structure": ["LLLLLLLLLLLLLLLSSSLLLLLLLLLLLSSSSLLLLSSSSLLLLLSSSSSSLLLLLLLLLSSSSSSSSLLHHHLLLLLLLLHHHHHLLLLLLLLLLLLLLLSSSSLLLLLSSSSLLLLLLSSSSSSLLLLLLLLLLLSSSSSSLLLLLLLLLLLLLLSSSSSSSSLLLLLSSSSSSSSSSSLLLHHHHHHHHHHHHL"], "residue_ids": ["G.113. ", "G.114. ", "G.115. ", "G.116. ", "G.117. ", "G.118. ", "G.119. ", "G.120. ", "G.121. ", "G.122. ", "G.123. ", "G.124. ", "G.125. ", "G.126. ", "G.127. ", "G.128. ", "G.129. ", "G.130. ", "G.131. ", "G.132. ", "G.133. ", "G.134. ", "G.135. ", "G.136. ", "G.137. ", "G.138. ", "G.139. ", "G.140. ", "G.141. ", "G.142. ", "G.143. ", "G.144. ", "G.145. ", "G.146. ", "G.147. ", "G.148. ", "G.149. ", "G.150. ", "G.151. ", "G.152. ", "G.153. ", "G.154. ", "G.155. ", "G.156. ", "G.157. ", "G.158. ", "G.159. ", "G.160. ", "G.161. ", "G.162. ", "G.163. ", "G.164. ", "G.165. ", "G.166. ", "G.167. ", "G.168. ", "G.169. ", "G.170. ", "G.171. ", "G.172. ", "G.173. ", "G.174. ", "G.175. ", "G.176. ", "G.177. ", "G.178. ", "G.179. ", "G.180. ", "G.181. ", "G.182. ", "G.183. ", "G.184. ", "G.185. ", "G.186. ", "G.187. ", "G.188. ", "G.189. ", "G.190. ", "G.191. ", "G.192. ", "G.193. ", "G.194. ", "G.195. ", "G.196. ", "G.197. ", "G.198. ", "G.199. ", "G.200. ", "G.201. ", "G.202. ", "G.203. ", "G.204. ", "G.205. ", "G.206. ", "G.207. ", "G.208. ", "G.209. ", "G.210. ", "G.211. ", "G.212. ", "G.213. ", "G.214. ", "G.215. ", "G.216. ", "G.217. ", "G.218. ", "G.219. ", "G.220. ", "G.221. ", "G.222. ", "G.223. ", "G.224. ", "G.225. ", "G.226. ", "G.227. ", "G.228. ", "G.229. ", "G.230. ", "G.231. ", "G.232. ", "G.233. ", "G.234. ", "G.235. ", "G.236. ", "G.237. ", "G.238. ", "G.239. ", "G.240. ", "G.241. ", "G.242. ", "G.243. ", "G.244. ", "G.245. ", "G.246. ", "G.247. ", "G.248. ", "G.249. ", "G.250. ", "G.251. ", "G.252. ", "G.253. ", "G.254. ", "G.255. ", "G.256. ", "G.257. ", "G.258. ", "G.259. ", "G.260. ", "G.261. ", "G.262. ", "G.263. ", "G.264. ", "G.265. ", "G.266. ", "G.267. ", "G.268. ", "G.269. ", "G.270. ", "G.271. ", "G.272. ", "G.273. ", "G.274. ", "G.275. ", "G.276. ", "G.277. ", "G.278. ", "G.279. ", "G.280. ", "G.281. ", "G.282. ", "G.283. ", "G.284. ", "G.285. ", "G.286. ", "G.287. ", "G.288. ", "G.289. ", "G.290. ", "G.291. ", "G.292. ", "G.293. ", "G.294. ", "G.295. ", "G.296. ", "G.297. ", "G.298. ", "G.299. ", "G.300. ", "G.301. ", "G.302. ", "G.303. ", "G.304. ", "G.305. ", "G.306. ", "G.307. ", "G.308. ", "G.309. ", "G.310. "], "organism": null, "id": "G"}, {"sequence_clusters": {}, "cath_architecture": null, "uniprot_accession": null, "sequence": "EFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYR", "GO_cellular_component": null, "continuous": [true], "cath_topology": null, "au_chain_id": "B", "uniprot_names": null, "GO_biological_process": null, "length": 198, "cath_class": null, "interacts_with_dna": [true], "GO_molecular_function": null, "cath_homologous_superfamily": null, "secondary_structure": ["LLLLLLLLLLLLLLLSSSLLLLLLLLLLLSSSSLLLLSSSSLLLLSSSSSSSLLLLLLLLLSSSSSSSSLLHHHLLLLLLLLHHHHLLLLLLLLLLLLLLLLSSSLLLLLLSSSSLLLLLLSSSSSSLLLLLLLLLLLSSSSSSLLLLLLLLLLLLLLSSSSSSSSLLLLLSSSSSSSSSSSLLLHHHHHHHHHHHHL"], "residue_ids": ["H.113. ", "H.114. ", "H.115. ", "H.116. ", "H.117. ", "H.118. ", "H.119. ", "H.120. ", "H.121. ", "H.122. ", "H.123. ", "H.124. ", "H.125. ", "H.126. ", "H.127. ", "H.128. ", "H.129. ", "H.130. ", "H.131. ", "H.132. ", "H.133. ", "H.134. ", "H.135. ", "H.136. ", "H.137. ", "H.138. ", "H.139. ", "H.140. ", "H.141. ", "H.142. ", "H.143. ", "H.144. ", "H.145. ", "H.146. ", "H.147. ", "H.148. ", "H.149. ", "H.150. ", "H.151. ", "H.152. ", "H.153. ", "H.154. ", "H.155. ", "H.156. ", "H.157. ", "H.158. ", "H.159. ", "H.160. ", "H.161. ", "H.162. ", "H.163. ", "H.164. ", "H.165. ", "H.166. ", "H.167. ", "H.168. ", "H.169. ", "H.170. ", "H.171. ", "H.172. ", "H.173. ", "H.174. ", "H.175. ", "H.176. ", "H.177. ", "H.178. ", "H.179. ", "H.180. ", "H.181. ", "H.182. ", "H.183. ", "H.184. ", "H.185. ", "H.186. ", "H.187. ", "H.188. ", "H.189. ", "H.190. ", "H.191. ", "H.192. ", "H.193. ", "H.194. ", "H.195. ", "H.196. ", "H.197. ", "H.198. ", "H.199. ", "H.200. ", "H.201. ", "H.202. ", "H.203. ", "H.204. ", "H.205. ", "H.206. ", "H.207. ", "H.208. ", "H.209. ", "H.210. ", "H.211. ", "H.212. ", "H.213. ", "H.214. ", "H.215. ", "H.216. ", "H.217. ", "H.218. ", "H.219. ", "H.220. ", "H.221. ", "H.222. ", "H.223. ", "H.224. ", "H.225. ", "H.226. ", "H.227. ", "H.228. ", "H.229. ", "H.230. ", "H.231. ", "H.232. ", "H.233. ", "H.234. ", "H.235. ", "H.236. ", "H.237. ", "H.238. ", "H.239. ", "H.240. ", "H.241. ", "H.242. ", "H.243. ", "H.244. ", "H.245. ", "H.246. ", "H.247. ", "H.248. ", "H.249. ", "H.250. ", "H.251. ", "H.252. ", "H.253. ", "H.254. ", "H.255. ", "H.256. ", "H.257. ", "H.258. ", "H.259. ", "H.260. ", "H.261. ", "H.262. ", "H.263. ", "H.264. ", "H.265. ", "H.266. ", "H.267. ", "H.268. ", "H.269. ", "H.270. ", "H.271. ", "H.272. ", "H.273. ", "H.274. ", "H.275. ", "H.276. ", "H.277. ", "H.278. ", "H.279. ", "H.280. ", "H.281. ", "H.282. ", "H.283. ", "H.284. ", "H.285. ", "H.286. ", "H.287. ", "H.288. ", "H.289. ", "H.290. ", "H.291. ", "H.292. ", "H.293. ", "H.294. ", "H.295. ", "H.296. ", "H.297. ", "H.298. ", "H.299. ", "H.300. ", "H.301. ", "H.302. ", "H.303. ", "H.304. ", "H.305. ", "H.306. ", "H.307. ", "H.308. ", "H.309. ", "H.310. "], "organism": null, "id": "H"}], "num_residues": 792, "residues": [{"ins_code": " ", "sesa": [{"sc": 41.7553, "total": 73.4392, "mc": 31.6839}], "name": "GLU", "chain": "A", "cv_coarse": [0.5450910793867607], "number": 113, "sap_score": [-4.3296467982196125], "cv_fine": [0.578456745591416], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 83.548, "total": 115.306, "mc": 31.758}], "id": "A.113. "}, {"ins_code": " ", "sesa": [{"sc": 33.5821, "total": 52.189499999999995, "mc": 18.6074}], "name": "PHE", "chain": "A", "cv_coarse": [0.6167119788745665], "number": 114, "sap_score": [-1.6209523405240598], "cv_fine": [0.7779502409212732], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 43.143, "total": 55.433, "mc": 12.29}], "id": "A.114. "}, {"ins_code": " ", "sesa": [{"sc": 117.2881, "total": 145.63899999999998, "mc": 28.3509}], "name": "ILE", "chain": "A", "cv_coarse": [0.7394921354252891], "number": 115, "sap_score": [1.9061984172610564], "cv_fine": [0.8977212920464013], "name_short": "I", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 52.268, "total": 65.704, "mc": 13.437}], "id": "A.115. "}, {"ins_code": " ", "sesa": [{"sc": 46.0819, "total": 63.086099999999995, "mc": 17.0042}], "name": "PRO", "chain": "A", "cv_coarse": [0.7551285531383328], "number": 116, "sap_score": [0.7573223434050543], "cv_fine": [0.8481696616252609], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 21.146, "total": 32.357, "mc": 11.211}], "id": "A.116. "}, {"ins_code": " ", "sesa": [{"sc": 33.392700000000005, "total": 51.7398, "mc": 18.3471}], "name": "SER", "chain": "A", "cv_coarse": [0.6966226327673927], "number": 117, "sap_score": [-0.6794191210179695], "cv_fine": [0.8738098557127293], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 18.731, "total": 22.278, "mc": 3.547}], "id": "A.117. "}, {"ins_code": " ", "sesa": [{"sc": 55.2769, "total": 76.64410000000001, "mc": 21.367199999999997}], "name": "ASN", "chain": "A", "cv_coarse": [0.721280069311206], "number": 118, "sap_score": [-0.9503658925324583], "cv_fine": [0.6720251324241485], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 73.648, "total": 84.955, "mc": 11.307}], "id": "A.118. "}, {"ins_code": " ", "sesa": [{"sc": 58.2649, "total": 58.2649, "mc": 0.0}], "name": "THR", "chain": "A", "cv_coarse": [0.5827275524770973], "number": 119, "sap_score": [-1.0856006429406426], "cv_fine": [0.6683328192490171], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 61.126, "total": 61.126, "mc": 0.0}], "id": "A.119. "}, {"ins_code": " ", "sesa": [{"sc": 39.4378, "total": 56.857, "mc": 17.4192}], "name": "ASP", "chain": "A", "cv_coarse": [0.5044297114691902], "number": 120, "sap_score": [-1.270058114555208], "cv_fine": [0.5761719796909324], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 45.128, "total": 60.713, "mc": 15.585}], "id": "A.120. "}, {"ins_code": " ", "sesa": [{"sc": 83.8477, "total": 83.8477, "mc": 0.0}], "name": "TYR", "chain": "A", "cv_coarse": [0.42582061445137215], "number": 121, "sap_score": [1.229213580964437], "cv_fine": [0.6571474494429778], "name_short": "Y", "surface": [true], "secondary_structure": ["L"], "chemical_name": "TYROSINE", "fasa": [{"sc": 87.324, "total": 87.324, "mc": 0.0}], "id": "A.121. "}, {"ins_code": " ", "sesa": [{"sc": 48.9215, "total": 60.5578, "mc": 11.6363}], "name": "PRO", "chain": "A", "cv_coarse": [0.36335661419926196], "number": 122, "sap_score": [0.5470000802269082], "cv_fine": [0.5352689380765207], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 60.477, "total": 71.19, "mc": 10.713}], "id": "A.122. "}, {"ins_code": " ", "sesa": [{"sc": 2.9923, "total": 15.3488, "mc": 12.3565}], "name": "GLY", "chain": "A", "cv_coarse": [0.3147154389550625], "number": 123, "sap_score": [0.933289394382974], "cv_fine": [0.598869743277947], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 0.301, "total": 12.412, "mc": 12.112}], "id": "A.123. "}, {"ins_code": " ", "sesa": [{"sc": 56.3319, "total": 78.86500000000001, "mc": 22.5331}], "name": "PRO", "chain": "A", "cv_coarse": [0.26199555490912363], "number": 124, "sap_score": [0.9284494870923922], "cv_fine": [0.45132589063796275], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 83.365, "total": 112.625, "mc": 29.26}], "id": "A.124. "}, {"ins_code": " ", "sesa": [{"sc": 28.7064, "total": 28.7064, "mc": 0.0}], "name": "HIS", "chain": "A", "cv_coarse": [0.24350669425822552], "number": 125, "sap_score": [0.5202791528360292], "cv_fine": [0.6465614530401476], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 24.337, "total": 24.337, "mc": 0.0}], "id": "A.125. "}, {"ins_code": " ", "sesa": [{"sc": 73.89, "total": 80.17089999999999, "mc": 6.280899999999999}], "name": "HIS", "chain": "A", "cv_coarse": [0.2680439834199545], "number": 126, "sap_score": [-1.1936058004295818], "cv_fine": [0.5254565065529933], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 91.741, "total": 91.953, "mc": 0.212}], "id": "A.126. "}, {"ins_code": " ", "sesa": [{"sc": 33.2754, "total": 33.2754, "mc": 0.0}], "name": "GLU", "chain": "A", "cv_coarse": [0.31318663748444603], "number": 128, "sap_score": [-1.392988628701512], "cv_fine": [0.6584188828269313], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 39.452, "total": 39.452, "mc": 0.0}], "id": "A.128. "}, {"ins_code": " ", "sesa": [{"sc": 6.362, "total": 22.945, "mc": 16.583}], "name": "VAL", "chain": "A", "cv_coarse": [0.39084258882708056], "number": 129, "sap_score": [0.19625120133587604], "cv_fine": [0.8715097443447716], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 1.53, "total": 12.915, "mc": 11.385}], "id": "A.129. "}, {"ins_code": " ", "sesa": [{"sc": 43.1829, "total": 43.1829, "mc": 0.0}], "name": "THR", "chain": "A", "cv_coarse": [0.3082161363772852], "number": 130, "sap_score": [0.5382356419396443], "cv_fine": [0.7419748582125169], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 46.748, "total": 46.748, "mc": 0.0}], "id": "A.130. "}, {"ins_code": " ", "sesa": [{"sc": 29.7591, "total": 48.904399999999995, "mc": 19.1453}], "name": "PHE", "chain": "A", "cv_coarse": [0.3399773112632101], "number": 131, "sap_score": [0.6739527415645621], "cv_fine": [0.8376598825911291], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 5.564, "total": 29.965, "mc": 24.402}], "id": "A.131. "}, {"ins_code": " ", "sesa": [{"sc": 76.588, "total": 88.7946, "mc": 12.2066}], "name": "GLN", "chain": "A", "cv_coarse": [0.21632794466089272], "number": 132, "sap_score": [-0.9696086900979278], "cv_fine": [0.5729093626189313], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 87.292, "total": 92.14, "mc": 4.848}], "id": "A.132. "}, {"ins_code": " ", "sesa": [{"sc": 79.7383, "total": 94.6677, "mc": 14.9294}], "name": "GLN", "chain": "A", "cv_coarse": [0.17942628885870382], "number": 133, "sap_score": [-2.28805233675412], "cv_fine": [0.4262524720624504], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 143.435, "total": 155.392, "mc": 11.957}], "id": "A.133. "}, {"ins_code": " ", "sesa": [{"sc": 26.235000000000003, "total": 52.06419999999999, "mc": 25.8292}], "name": "SER", "chain": "A", "cv_coarse": [0.21271629677387424], "number": 134, "sap_score": [-1.9120209097857608], "cv_fine": [0.6519291399643378], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 9.558, "total": 28.514, "mc": 18.956}], "id": "A.134. "}, {"ins_code": " ", "sesa": [{"sc": 35.2101, "total": 46.8974, "mc": 11.6873}], "name": "SER", "chain": "A", "cv_coarse": [0.1740559214852158], "number": 135, "sap_score": [-0.8246308369082916], "cv_fine": [0.5395568698945613], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 54.977, "total": 64.899, "mc": 9.922}], "id": "A.135. "}, {"ins_code": " ", "sesa": [{"sc": 64.91409999999999, "total": 86.83590000000001, "mc": 21.9218}], "name": "THR", "chain": "A", "cv_coarse": [0.16914908960039954], "number": 136, "sap_score": [-0.4280031836445116], "cv_fine": [0.45393608556201887], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 106.093, "total": 124.665, "mc": 18.572}], "id": "A.136. "}, {"ins_code": " ", "sesa": [{"sc": 36.3673, "total": 45.2089, "mc": 8.8416}], "name": "ALA", "chain": "A", "cv_coarse": [0.15861679832124845], "number": 137, "sap_score": [-0.5647851518146676], "cv_fine": [0.46681079323092634], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 53.806, "total": 54.578, "mc": 0.771}], "id": "A.137. "}, {"ins_code": " ", "sesa": [{"sc": 78.1284, "total": 98.2995, "mc": 20.1711}], "name": "LYS", "chain": "A", "cv_coarse": [0.1689274166449412], "number": 138, "sap_score": [-1.2105381377793756], "cv_fine": [0.4656792970752368], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 104.052, "total": 120.345, "mc": 16.293}], "id": "A.138. "}, {"ins_code": " ", "sesa": [{"sc": 42.5868, "total": 65.63900000000001, "mc": 23.0522}], "name": "SER", "chain": "A", "cv_coarse": [0.15414449350050088], "number": 139, "sap_score": [-0.7427692712376824], "cv_fine": [0.3840009642870816], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 83.629, "total": 103.585, "mc": 19.955}], "id": "A.139. "}, {"ins_code": " ", "sesa": [{"sc": 12.9591, "total": 23.230400000000003, "mc": 10.2713}], "name": "ALA", "chain": "A", "cv_coarse": [0.19623849538565866], "number": 140, "sap_score": [-0.6419173316075875], "cv_fine": [0.6160761431993269], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 8.343, "total": 10.224, "mc": 1.881}], "id": "A.140. "}, {"ins_code": " ", "sesa": [{"sc": 45.1525, "total": 52.8317, "mc": 7.6792}], "name": "THR", "chain": "A", "cv_coarse": [0.22259646776391692], "number": 141, "sap_score": [-0.11934755911157438], "cv_fine": [0.643409559275728], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 52.821, "total": 57.706, "mc": 4.885}], "id": "A.141. "}, {"ins_code": " ", "sesa": [{"sc": 38.188, "total": 46.780100000000004, "mc": 8.5921}], "name": "TRP", "chain": "A", "cv_coarse": [0.2767100483105125], "number": 142, "sap_score": [0.3335233014595834], "cv_fine": [0.8320042074059009], "name_short": "W", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TRYPTOPHAN", "fasa": [{"sc": 20.28, "total": 22.109, "mc": 1.829}], "id": "A.142. "}, {"ins_code": " ", "sesa": [{"sc": 14.9164, "total": 14.9164, "mc": 0.0}], "name": "THR", "chain": "A", "cv_coarse": [0.29271394725577604], "number": 143, "sap_score": [-0.388240278846067], "cv_fine": [0.888020884309139], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 2.867, "total": 2.867, "mc": 0.0}], "id": "A.143. "}, {"ins_code": " ", "sesa": [{"sc": 41.1235, "total": 54.0611, "mc": 12.9376}], "name": "TYR", "chain": "A", "cv_coarse": [0.3630468591123679], "number": 144, "sap_score": [0.4390575049411882], "cv_fine": [0.8113313437024517], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 25.749, "total": 32.371, "mc": 6.622}], "id": "A.144. "}, {"ins_code": " ", "sesa": [{"sc": 3.5147, "total": 3.5147, "mc": 0.0}], "name": "SER", "chain": "A", "cv_coarse": [0.3350997670806429], "number": 145, "sap_score": [0.7067929013512391], "cv_fine": [0.7161142123651693], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 0.736, "total": 0.736, "mc": 0.0}], "id": "A.145. "}, {"ins_code": " ", "sesa": [{"sc": 51.890800000000006, "total": 68.1828, "mc": 16.291999999999998}], "name": "PRO", "chain": "A", "cv_coarse": [0.30463486105227616], "number": 146, "sap_score": [2.181176626320638], "cv_fine": [0.49095137021659857], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 80.889, "total": 100.688, "mc": 19.799}], "id": "A.146. "}, {"ins_code": " ", "sesa": [{"sc": 64.6763, "total": 83.50140000000002, "mc": 18.8251}], "name": "LEU", "chain": "A", "cv_coarse": [0.3108291760185028], "number": 147, "sap_score": [3.544389026345447], "cv_fine": [0.4848952191527499], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 79.361, "total": 105.354, "mc": 25.992}], "id": "A.147. "}, {"ins_code": " ", "sesa": [{"sc": 45.7427, "total": 54.9567, "mc": 9.214}], "name": "LEU", "chain": "A", "cv_coarse": [0.41212628506898985], "number": 148, "sap_score": [1.986338916570226], "cv_fine": [0.5867994644080989], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 52.468, "total": 58.219, "mc": 5.752}], "id": "A.148. "}, {"ins_code": " ", "sesa": [{"sc": 65.5184, "total": 69.912, "mc": 4.3936}], "name": "LYS", "chain": "A", "cv_coarse": [0.4543862163350229], "number": 149, "sap_score": [-0.45366160233020514], "cv_fine": [0.6603284864694001], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 72.327, "total": 73.041, "mc": 0.714}], "id": "A.149. "}, {"ins_code": " ", "sesa": [{"sc": 30.9583, "total": 30.9583, "mc": 0.0}], "name": "LYS", "chain": "A", "cv_coarse": [0.46847732453095464], "number": 150, "sap_score": [-0.39046234958587306], "cv_fine": [0.8028274567716727], "name_short": "K", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LYSINE", "fasa": [{"sc": 26.131, "total": 26.131, "mc": 0.0}], "id": "A.150. "}, {"ins_code": " ", "sesa": [{"sc": 47.8929, "total": 47.8929, "mc": 0.0}], "name": "GLN", "chain": "A", "cv_coarse": [0.268870708344279], "number": 154, "sap_score": [-0.2946889684545123], "cv_fine": [0.6859848997273316], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 53.525, "total": 53.525, "mc": 0.0}], "id": "A.154. "}, {"ins_code": " ", "sesa": [{"sc": 45.9084, "total": 59.3718, "mc": 13.4634}], "name": "ILE", "chain": "A", "cv_coarse": [0.2944745347965988], "number": 155, "sap_score": [0.651078140715623], "cv_fine": [0.7022197683225517], "name_short": "I", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 56.885, "total": 60.923, "mc": 4.037}], "id": "A.155. "}, {"ins_code": " ", "sesa": [{"sc": 14.5881, "total": 30.4566, "mc": 15.8685}], "name": "ALA", "chain": "A", "cv_coarse": [0.2631034760399536], "number": 156, "sap_score": [1.0217590345577288], "cv_fine": [0.6728257038026773], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 4.524, "total": 17.578, "mc": 13.054}], "id": "A.156. "}, {"ins_code": " ", "sesa": [{"sc": 68.1117, "total": 68.1117, "mc": 0.0}], "name": "LYS", "chain": "A", "cv_coarse": [0.23066737337988708], "number": 157, "sap_score": [-0.5947863789229232], "cv_fine": [0.5590121741232426], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 97.524, "total": 97.524, "mc": 0.0}], "id": "A.157. "}, {"ins_code": " ", "sesa": [{"sc": 28.4763, "total": 49.81759999999999, "mc": 21.341299999999997}], "name": "THR", "chain": "A", "cv_coarse": [0.2432661386409151], "number": 158, "sap_score": [-0.24304318418633888], "cv_fine": [0.607376149059237], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 35.809, "total": 46.965, "mc": 11.155}], "id": "A.158. "}, {"ins_code": " ", "sesa": [{"sc": 34.132400000000004, "total": 42.7734, "mc": 8.641}], "name": "PRO", "chain": "A", "cv_coarse": [0.28601873318192383], "number": 160, "sap_score": [0.5563399627786356], "cv_fine": [0.7918812692578056], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 23.888, "total": 26.619, "mc": 2.731}], "id": "A.160. "}, {"ins_code": " ", "sesa": [{"sc": 5.1339, "total": 10.499099999999999, "mc": 5.3652}], "name": "ILE", "chain": "A", "cv_coarse": [0.35460797006024114], "number": 161, "sap_score": [0.34678263929101394], "cv_fine": [0.9321976728510393], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 9.775, "total": 10.584, "mc": 0.809}], "id": "A.161. "}, {"ins_code": " ", "sesa": [{"sc": 34.8483, "total": 34.8483, "mc": 0.0}], "name": "GLN", "chain": "A", "cv_coarse": [0.27932227148357963], "number": 162, "sap_score": [1.00280600273605], "cv_fine": [0.83842443415712], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 13.793, "total": 13.793, "mc": 0.0}], "id": "A.162. "}, {"ins_code": " ", "sesa": [{"sc": 57.126200000000004, "total": 58.7899, "mc": 1.6637}], "name": "LYS", "chain": "A", "cv_coarse": [0.25546400924541857], "number": 164, "sap_score": [-0.8540816922347108], "cv_fine": [0.7034352234348404], "name_short": "K", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LYSINE", "fasa": [{"sc": 61.108, "total": 61.108, "mc": 0.0}], "id": "A.164. "}, {"ins_code": " ", "sesa": [{"sc": 17.0732, "total": 41.6788, "mc": 24.6056}], "name": "VAL", "chain": "A", "cv_coarse": [0.23757602823439414], "number": 165, "sap_score": [0.3008136536626753], "cv_fine": [0.7930541392944453], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 8.795, "total": 37.332, "mc": 28.537}], "id": "A.165. "}, {"ins_code": " ", "sesa": [{"sc": 35.5531, "total": 56.258700000000005, "mc": 20.7056}], "name": "SER", "chain": "A", "cv_coarse": [0.19836907112331695], "number": 166, "sap_score": [-0.06589375083265836], "cv_fine": [0.48495609727877703], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 47.841, "total": 75.961, "mc": 28.119}], "id": "A.166. "}, {"ins_code": " ", "sesa": [{"sc": 47.2821, "total": 47.2821, "mc": 0.0}], "name": "THR", "chain": "A", "cv_coarse": [0.1889896867830539], "number": 167, "sap_score": [0.17008214597664922], "cv_fine": [0.5046299989066237], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 71.925, "total": 73.407, "mc": 1.482}], "id": "A.167. "}, {"ins_code": " ", "sesa": [{"sc": 49.8084, "total": 58.4258, "mc": 8.6174}], "name": "PRO", "chain": "A", "cv_coarse": [0.1797382147722777], "number": 168, "sap_score": [1.4119401410508086], "cv_fine": [0.5661717799989353], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 64.313, "total": 68.738, "mc": 4.425}], "id": "A.168. "}, {"ins_code": " ", "sesa": [{"sc": 45.1905, "total": 45.1905, "mc": 0.0}], "name": "PRO", "chain": "A", "cv_coarse": [0.19905540795279056], "number": 169, "sap_score": [1.5548272455575474], "cv_fine": [0.6438886265587297], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 49.284, "total": 53.568, "mc": 4.283}], "id": "A.169. "}, {"ins_code": " ", "sesa": [{"sc": 41.775, "total": 44.5763, "mc": 2.8013}], "name": "PRO", "chain": "A", "cv_coarse": [0.20408558087717252], "number": 170, "sap_score": [1.2119400929845778], "cv_fine": [0.5403871225976781], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 51.83, "total": 52.118, "mc": 0.287}], "id": "A.170. "}, {"ins_code": " ", "sesa": [{"sc": 63.735299999999995, "total": 70.03410000000001, "mc": 6.2988}], "name": "PRO", "chain": "A", "cv_coarse": [0.17503580455547882], "number": 171, "sap_score": [0.45597810895563784], "cv_fine": [0.38748136677714795], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 104.196, "total": 105.236, "mc": 1.041}], "id": "A.171. "}, {"ins_code": " ", "sesa": [{"sc": 15.7576, "total": 37.7018, "mc": 21.944200000000002}], "name": "GLY", "chain": "A", "cv_coarse": [0.22001219622185197], "number": 172, "sap_score": [-0.9413710635872813], "cv_fine": [0.5401990264675167], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 25.521, "total": 46.382, "mc": 20.862}], "id": "A.172. "}, {"ins_code": " ", "sesa": [{"sc": 6.4004, "total": 21.081, "mc": 14.6806}], "name": "THR", "chain": "A", "cv_coarse": [0.2616830511216925], "number": 173, "sap_score": [0.3092997920609187], "cv_fine": [0.8076131639927782], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 1.59, "total": 5.648, "mc": 4.058}], "id": "A.173. "}, {"ins_code": " ", "sesa": [{"sc": 28.0752, "total": 28.0752, "mc": 0.0}], "name": "ALA", "chain": "A", "cv_coarse": [0.33198986226573035], "number": 174, "sap_score": [0.19157801282391881], "cv_fine": [0.8560161640257519], "name_short": "A", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ALANINE", "fasa": [{"sc": 20.46, "total": 20.46, "mc": 0.0}], "id": "A.174. "}, {"ins_code": " ", "sesa": [{"sc": 9.3485, "total": 14.492799999999999, "mc": 5.1443}], "name": "ILE", "chain": "A", "cv_coarse": [0.3831186757787578], "number": 175, "sap_score": [0.16198579357728737], "cv_fine": [0.9408341305626134], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 1.872, "total": 2.024, "mc": 0.151}], "id": "A.175. "}, {"ins_code": " ", "sesa": [{"sc": 47.035399999999996, "total": 47.035399999999996, "mc": 0.0}], "name": "ARG", "chain": "A", "cv_coarse": [0.48458583616958556], "number": 176, "sap_score": [-0.5645244790041609], "cv_fine": [0.8613546641590095], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 40.978, "total": 40.978, "mc": 0.0}], "id": "A.176. "}, {"ins_code": " ", "sesa": [{"sc": 35.550399999999996, "total": 35.550399999999996, "mc": 0.0}], "name": "MET", "chain": "A", "cv_coarse": [0.6467672128663289], "number": 178, "sap_score": [-0.12581744556523963], "cv_fine": [0.9102065258353491], "name_short": "M", "surface": [true], "secondary_structure": ["S"], "chemical_name": "METHIONINE", "fasa": [{"sc": 21.906, "total": 21.906, "mc": 0.0}], "id": "A.178. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 10.6251, "mc": 10.6251}], "name": "PRO", "chain": "A", "cv_coarse": [0.6713762837871328], "number": 179, "sap_score": [0.10802782970473845], "cv_fine": [0.955062969289642], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 0.216, "total": 5.144, "mc": 4.928}], "id": "A.179. "}, {"ins_code": " ", "sesa": [{"sc": 45.525400000000005, "total": 45.525400000000005, "mc": 0.0}], "name": "VAL", "chain": "A", "cv_coarse": [0.7998771819796883], "number": 180, "sap_score": [0.2825032752666281], "cv_fine": [0.9132497346567743], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 15.874, "total": 15.874, "mc": 0.0}], "id": "A.180. "}, {"ins_code": " ", "sesa": [{"sc": 12.578800000000001, "total": 28.6797, "mc": 16.1009}], "name": "TYR", "chain": "A", "cv_coarse": [0.7359306081988811], "number": 181, "sap_score": [-0.10062523322212294], "cv_fine": [0.897887309464791], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 2.222, "total": 8.127, "mc": 5.905}], "id": "A.181. "}, {"ins_code": " ", "sesa": [{"sc": 74.39890000000001, "total": 88.1752, "mc": 13.7763}], "name": "LYS", "chain": "A", "cv_coarse": [0.7389646273102073], "number": 182, "sap_score": [-0.613286998895461], "cv_fine": [0.612636614772206], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 83.512, "total": 101.033, "mc": 17.521}], "id": "A.182. "}, {"ins_code": " ", "sesa": [{"sc": 74.29429999999999, "total": 77.81469999999999, "mc": 3.5204}], "name": "LYS", "chain": "A", "cv_coarse": [0.7005288825204316], "number": 183, "sap_score": [-0.5349766598256233], "cv_fine": [0.6624480605515957], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 104.963, "total": 105.117, "mc": 0.153}], "id": "A.183. "}, {"ins_code": " ", "sesa": [{"sc": 32.875, "total": 41.5694, "mc": 8.6944}], "name": "ALA", "chain": "A", "cv_coarse": [0.8259335163592558], "number": 184, "sap_score": [-0.03959050059824624], "cv_fine": [0.8057423936752433], "name_short": "A", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ALANINE", "fasa": [{"sc": 28.725, "total": 35.196, "mc": 6.471}], "id": "A.184. "}, {"ins_code": " ", "sesa": [{"sc": 41.7452, "total": 55.680499999999995, "mc": 13.935300000000002}], "name": "GLU", "chain": "A", "cv_coarse": [0.688720033596657], "number": 185, "sap_score": [-0.845958699618819], "cv_fine": [0.7770515717622476], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 33.336, "total": 36.962, "mc": 3.626}], "id": "A.185. "}, {"ins_code": " ", "sesa": [{"sc": 34.93769999999999, "total": 34.93769999999999, "mc": 0.0}], "name": "HIS", "chain": "A", "cv_coarse": [0.6824782029838827], "number": 186, "sap_score": [-1.123251984219106], "cv_fine": [0.7608117344119576], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 33.751, "total": 33.751, "mc": 0.0}], "id": "A.186. "}, {"ins_code": " ", "sesa": [{"sc": 48.161, "total": 63.763400000000004, "mc": 15.6024}], "name": "VAL", "chain": "A", "cv_coarse": [0.8502134638959683], "number": 187, "sap_score": [0.37916802854417186], "cv_fine": [0.8811239968642701], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 21.898, "total": 38.916, "mc": 17.018}], "id": "A.187. "}, {"ins_code": " ", "sesa": [{"sc": 44.4246, "total": 63.177400000000006, "mc": 18.7528}], "name": "THR", "chain": "A", "cv_coarse": [0.712511911222293], "number": 188, "sap_score": [-0.27026325559347103], "cv_fine": [0.7283926030984389], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 46.476, "total": 60.657, "mc": 14.181}], "id": "A.188. "}, {"ins_code": " ", "sesa": [{"sc": 52.1869, "total": 61.576499999999996, "mc": 9.3896}], "name": "ASP", "chain": "A", "cv_coarse": [0.6305376543279262], "number": 189, "sap_score": [-0.15020669349600252], "cv_fine": [0.6238328393090216], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 68.791, "total": 69.832, "mc": 1.041}], "id": "A.189. "}, {"ins_code": " ", "sesa": [{"sc": 46.4, "total": 67.60629999999999, "mc": 21.2063}], "name": "VAL", "chain": "A", "cv_coarse": [0.5900130836156066], "number": 190, "sap_score": [1.441521725233997], "cv_fine": [0.6760893194478044], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 40.917, "total": 60.19, "mc": 19.274}], "id": "A.190. "}, {"ins_code": " ", "sesa": [{"sc": 17.1482, "total": 23.2399, "mc": 6.0917}], "name": "VAL", "chain": "A", "cv_coarse": [0.632488810592364], "number": 191, "sap_score": [1.4171654804235567], "cv_fine": [0.8955539878656843], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 4.761, "total": 7.451, "mc": 2.69}], "id": "A.191. "}, {"ins_code": " ", "sesa": [{"sc": 60.548, "total": 71.0872, "mc": 10.539200000000001}], "name": "LYS", "chain": "A", "cv_coarse": [0.4850073824238609], "number": 192, "sap_score": [-0.3284922536895489], "cv_fine": [0.71784710709898], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 76.335, "total": 78.774, "mc": 2.439}], "id": "A.192. "}, {"ins_code": " ", "sesa": [{"sc": 10.9099, "total": 26.8734, "mc": 15.9635}], "name": "ARG", "chain": "A", "cv_coarse": [0.38451884904709144], "number": 193, "sap_score": [-0.45133715166973587], "cv_fine": [0.8890456536417058], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 4.65, "total": 12.073, "mc": 7.423}], "id": "A.193. "}, {"ins_code": " ", "sesa": [{"sc": 10.3689, "total": 10.3689, "mc": 0.0}], "name": "CYS", "chain": "A", "cv_coarse": [0.3687466451982422], "number": 194, "sap_score": [-0.2962092576980816], "cv_fine": [0.7463753374388334], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 1.189, "total": 1.189, "mc": 0.0}], "id": "A.194. "}, {"ins_code": " ", "sesa": [{"sc": 55.507999999999996, "total": 57.8349, "mc": 2.3269}], "name": "PRO", "chain": "A", "cv_coarse": [0.31621448039113664], "number": 195, "sap_score": [0.1974816757543473], "cv_fine": [0.4879083580742904], "name_short": "P", "surface": [true], "secondary_structure": ["H"], "chemical_name": "PROLINE", "fasa": [{"sc": 34.413, "total": 34.432, "mc": 0.019}], "id": "A.195. "}, {"ins_code": " ", "sesa": [{"sc": 61.8412, "total": 79.5535, "mc": 17.7123}], "name": "ASN", "chain": "A", "cv_coarse": [0.25611151012767974], "number": 196, "sap_score": [0.20883094390404222], "cv_fine": [0.45348902456665036], "name_short": "N", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 19.438, "total": 25.91, "mc": 6.473}], "id": "A.196. "}, {"ins_code": " ", "sesa": [{"sc": 44.22, "total": 49.7374, "mc": 5.5174}], "name": "HIS", "chain": "A", "cv_coarse": [0.30540186760160337], "number": 197, "sap_score": [-0.5906968071020038], "cv_fine": [0.7355251901129743], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 48.067, "total": 51.542, "mc": 3.475}], "id": "A.197. "}, {"ins_code": " ", "sesa": [{"sc": 53.7607, "total": 61.125099999999996, "mc": 7.3644}], "name": "GLU", "chain": "A", "cv_coarse": [0.3020380434967088], "number": 198, "sap_score": [-0.3942714417897482], "cv_fine": [0.5730617554155499], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 69.74, "total": 74.449, "mc": 4.709}], "id": "A.198. "}, {"ins_code": " ", "sesa": [{"sc": 69.4267, "total": 84.9138, "mc": 15.4871}], "name": "LEU", "chain": "A", "cv_coarse": [0.22824033653640438], "number": 199, "sap_score": [1.6049303628597336], "cv_fine": [0.42065872633238505], "name_short": "L", "surface": [true], "secondary_structure": ["H"], "chemical_name": "LEUCINE", "fasa": [{"sc": 50.462, "total": 76.325, "mc": 25.863}], "id": "A.199. "}, {"ins_code": " ", "sesa": [{"sc": 18.8407, "total": 31.4561, "mc": 12.615400000000001}], "name": "GLY", "chain": "A", "cv_coarse": [0.20629407746268794], "number": 200, "sap_score": [-0.7302766655629201], "cv_fine": [0.6185950557302753], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 21.522, "total": 27.288, "mc": 5.766}], "id": "A.200. "}, {"ins_code": " ", "sesa": [{"sc": 110.096, "total": 129.5925, "mc": 19.4965}], "name": "ARG", "chain": "A", "cv_coarse": [0.148047829439949], "number": 201, "sap_score": [-3.8239682769079786], "cv_fine": [0.3940445701145528], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 177.734, "total": 191.208, "mc": 13.474}], "id": "A.201. "}, {"ins_code": " ", "sesa": [{"sc": 60.7839, "total": 81.5498, "mc": 20.765900000000002}], "name": "ASP", "chain": "A", "cv_coarse": [0.1800800817807734], "number": 202, "sap_score": [-2.1529113737914964], "cv_fine": [0.4944648199068677], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 90.368, "total": 109.074, "mc": 18.706}], "id": "A.202. "}, {"ins_code": " ", "sesa": [{"sc": 85.8275, "total": 96.1056, "mc": 10.2781}], "name": "PHE", "chain": "A", "cv_coarse": [0.2141118020104275], "number": 203, "sap_score": [0.8192553350985089], "cv_fine": [0.6727181423080345], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 98.007, "total": 100.558, "mc": 2.551}], "id": "A.203. "}, {"ins_code": " ", "sesa": [{"sc": 34.461099999999995, "total": 47.86559999999999, "mc": 13.4045}], "name": "ASN", "chain": "A", "cv_coarse": [0.22065075618173324], "number": 204, "sap_score": [-0.9951847391778704], "cv_fine": [0.7140299635675538], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 20.088, "total": 33.562, "mc": 13.474}], "id": "A.204. "}, {"ins_code": " ", "sesa": [{"sc": 78.6912, "total": 97.31909999999999, "mc": 18.6279}], "name": "GLU", "chain": "A", "cv_coarse": [0.1478759604405779], "number": 205, "sap_score": [-2.9851605036400515], "cv_fine": [0.3935531337616148], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 126.852, "total": 147.975, "mc": 21.123}], "id": "A.205. "}, {"ins_code": " ", "sesa": [{"sc": 21.076, "total": 52.06100000000001, "mc": 30.985}], "name": "GLY", "chain": "A", "cv_coarse": [0.16395339743632756], "number": 206, "sap_score": [-2.005743725286094], "cv_fine": [0.4427589295475214], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 39.444, "total": 78.87, "mc": 39.426}], "id": "A.206. "}, {"ins_code": " ", "sesa": [{"sc": 57.884, "total": 75.4668, "mc": 17.5828}], "name": "GLN", "chain": "A", "cv_coarse": [0.2096417939930742], "number": 207, "sap_score": [-1.1966080407745412], "cv_fine": [0.6167975848757664], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 64.191, "total": 79.408, "mc": 15.217}], "id": "A.207. "}, {"ins_code": " ", "sesa": [{"sc": 42.7094, "total": 64.5669, "mc": 21.8575}], "name": "SER", "chain": "A", "cv_coarse": [0.20365243853014695], "number": 208, "sap_score": [-0.854730833903703], "cv_fine": [0.4745736932529918], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 84.939, "total": 115.352, "mc": 30.412}], "id": "A.208. "}, {"ins_code": " ", "sesa": [{"sc": 12.191199999999998, "total": 26.2315, "mc": 14.0403}], "name": "ALA", "chain": "A", "cv_coarse": [0.26187946530721334], "number": 209, "sap_score": [0.011773923104834725], "cv_fine": [0.6538495114788596], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 5.817, "total": 13.249, "mc": 7.432}], "id": "A.209. "}, {"ins_code": " ", "sesa": [{"sc": 42.250699999999995, "total": 43.726499999999994, "mc": 1.4758}], "name": "PRO", "chain": "A", "cv_coarse": [0.306570319808695], "number": 210, "sap_score": [0.6632369985233326], "cv_fine": [0.6277840623133832], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 54.476, "total": 54.838, "mc": 0.363}], "id": "A.210. "}, {"ins_code": " ", "sesa": [{"sc": 22.953899999999997, "total": 30.8517, "mc": 7.8978}], "name": "ALA", "chain": "A", "cv_coarse": [0.3109295162140982], "number": 211, "sap_score": [0.30225975840917946], "cv_fine": [0.6969954538027745], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 24.743, "total": 31.447, "mc": 6.704}], "id": "A.211. "}, {"ins_code": " ", "sesa": [{"sc": 32.6066, "total": 38.2783, "mc": 5.6717}], "name": "SER", "chain": "A", "cv_coarse": [0.38486716322419784], "number": 212, "sap_score": [-0.44485326439876943], "cv_fine": [0.6824881282999226], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 23.224, "total": 25.19, "mc": 1.967}], "id": "A.212. "}, {"ins_code": " ", "sesa": [{"sc": 10.5702, "total": 10.5702, "mc": 0.0}], "name": "HIS", "chain": "A", "cv_coarse": [0.4125892162434804], "number": 213, "sap_score": [-0.07621716878420262], "cv_fine": [0.846801589994578], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 3.093, "total": 3.093, "mc": 0.0}], "id": "A.213. "}, {"ins_code": " ", "sesa": [{"sc": 30.5037, "total": 30.5037, "mc": 0.0}], "name": "ARG", "chain": "A", "cv_coarse": [0.3336281630868468], "number": 216, "sap_score": [-0.11299184259381972], "cv_fine": [0.9030428119661537], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 6.117, "total": 6.117, "mc": 0.0}], "id": "A.216. "}, {"ins_code": " ", "sesa": [{"sc": 15.2685, "total": 33.6662, "mc": 18.3977}], "name": "VAL", "chain": "A", "cv_coarse": [0.3022069737519825], "number": 217, "sap_score": [-0.30452691898387385], "cv_fine": [0.8419796487153114], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 3.641, "total": 15.948, "mc": 12.308}], "id": "A.217. "}, {"ins_code": " ", "sesa": [{"sc": 50.58879999999999, "total": 59.79749999999999, "mc": 9.2087}], "name": "GLU", "chain": "A", "cv_coarse": [0.2298284827098722], "number": 218, "sap_score": [-0.615862887801087], "cv_fine": [0.57667576740949], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 62.429, "total": 67.361, "mc": 4.932}], "id": "A.218. "}, {"ins_code": " ", "sesa": [{"sc": 20.5136, "total": 52.0234, "mc": 31.5098}], "name": "GLY", "chain": "A", "cv_coarse": [0.1893491186310407], "number": 219, "sap_score": [-0.618734408584601], "cv_fine": [0.446389669777461], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 37.784, "total": 86.509, "mc": 48.725}], "id": "A.219. "}, {"ins_code": " ", "sesa": [{"sc": 41.9499, "total": 59.7597, "mc": 17.8098}], "name": "ASN", "chain": "A", "cv_coarse": [0.2189971204855934], "number": 220, "sap_score": [-1.0865515571372242], "cv_fine": [0.6220310854938119], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 46.676, "total": 57.459, "mc": 10.783}], "id": "A.220. "}, {"ins_code": " ", "sesa": [{"sc": 65.989, "total": 95.2244, "mc": 29.2354}], "name": "ASN", "chain": "A", "cv_coarse": [0.17357593100301583], "number": 221, "sap_score": [-1.4761789565275627], "cv_fine": [0.3960309945434663], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 129.173, "total": 157.141, "mc": 27.968}], "id": "A.221. "}, {"ins_code": " ", "sesa": [{"sc": 75.8081, "total": 83.4939, "mc": 7.6858}], "name": "LEU", "chain": "A", "cv_coarse": [0.20084375685117947], "number": 222, "sap_score": [1.0280208912397257], "cv_fine": [0.44175830713237296], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 118.527, "total": 120.34, "mc": 1.813}], "id": "A.222. "}, {"ins_code": " ", "sesa": [{"sc": 10.9324, "total": 24.1998, "mc": 13.2674}], "name": "SER", "chain": "A", "cv_coarse": [0.26567576748953675], "number": 223, "sap_score": [-0.09737840944231659], "cv_fine": [0.7321161847564558], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 7.936, "total": 19.146, "mc": 11.209}], "id": "A.223. "}, {"ins_code": " ", "sesa": [{"sc": 68.7435, "total": 68.7435, "mc": 0.0}], "name": "GLN", "chain": "A", "cv_coarse": [0.28222064622661713], "number": 224, "sap_score": [-0.3904998671419573], "cv_fine": [0.53400744699923], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 94.115, "total": 94.115, "mc": 0.0}], "id": "A.224. "}, {"ins_code": " ", "sesa": [{"sc": 30.084, "total": 55.5236, "mc": 25.4396}], "name": "TYR", "chain": "A", "cv_coarse": [0.3353937957075177], "number": 225, "sap_score": [0.5904586302116234], "cv_fine": [0.7619778500190356], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 17.427, "total": 44.317, "mc": 26.89}], "id": "A.225. "}, {"ins_code": " ", "sesa": [{"sc": 41.3658, "total": 41.3658, "mc": 0.0}], "name": "VAL", "chain": "A", "cv_coarse": [0.39890845442621403], "number": 226, "sap_score": [0.20896126933782488], "cv_fine": [0.6772767466496675], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 45.406, "total": 45.406, "mc": 0.0}], "id": "A.226. "}, {"ins_code": " ", "sesa": [{"sc": 47.9858, "total": 65.0797, "mc": 17.0939}], "name": "ASP", "chain": "A", "cv_coarse": [0.3878852901064055], "number": 227, "sap_score": [-1.229137398807559], "cv_fine": [0.5907292650362781], "name_short": "D", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 59.111, "total": 73.104, "mc": 13.993}], "id": "A.227. "}, {"ins_code": " ", "sesa": [{"sc": 40.718, "total": 45.2686, "mc": 4.5506}], "name": "ASP", "chain": "A", "cv_coarse": [0.4364204261232879], "number": 228, "sap_score": [-0.5188356585159181], "cv_fine": [0.6375288359521579], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 36.486, "total": 38.258, "mc": 1.772}], "id": "A.228. "}, {"ins_code": " ", "sesa": [{"sc": 64.1612, "total": 82.21079999999999, "mc": 18.0496}], "name": "PRO", "chain": "A", "cv_coarse": [0.3508177182847301], "number": 229, "sap_score": [1.4739700071921522], "cv_fine": [0.32722756732487873], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 103.907, "total": 134.711, "mc": 30.804}], "id": "A.229. "}, {"ins_code": " ", "sesa": [{"sc": 69.3386, "total": 84.9592, "mc": 15.6206}], "name": "VAL", "chain": "A", "cv_coarse": [0.4001902021971628], "number": 230, "sap_score": [1.7579614232877003], "cv_fine": [0.4176144304963074], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 117.568, "total": 143.876, "mc": 26.308}], "id": "A.230. "}, {"ins_code": " ", "sesa": [{"sc": 32.66330000000001, "total": 47.988200000000006, "mc": 15.3249}], "name": "THR", "chain": "A", "cv_coarse": [0.5186979330792064], "number": 231, "sap_score": [-0.28231364593154923], "cv_fine": [0.7331764495858915], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 24.531, "total": 41.534, "mc": 17.004}], "id": "A.231. "}, {"ins_code": " ", "sesa": [{"sc": 14.8024, "total": 23.6452, "mc": 8.8428}], "name": "GLY", "chain": "A", "cv_coarse": [0.4998965717664983], "number": 232, "sap_score": [-0.14180068800184428], "cv_fine": [0.6889574260920841], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 17.841, "total": 19.035, "mc": 1.194}], "id": "A.232. "}, {"ins_code": " ", "sesa": [{"sc": 71.86710000000001, "total": 80.22220000000002, "mc": 8.3551}], "name": "ARG", "chain": "A", "cv_coarse": [0.5884952150602888], "number": 233, "sap_score": [-1.2296044725955697], "cv_fine": [0.8199278755765659], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 48.387, "total": 49.108, "mc": 0.721}], "id": "A.233. "}, {"ins_code": " ", "sesa": [{"sc": 11.673200000000001, "total": 14.291500000000001, "mc": 2.6183}], "name": "GLN", "chain": "A", "cv_coarse": [0.5489450027873303], "number": 234, "sap_score": [0.09668830165589215], "cv_fine": [0.9008631227007391], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 5.104, "total": 5.104, "mc": 0.0}], "id": "A.234. "}, {"ins_code": " ", "sesa": [{"sc": 13.113299999999999, "total": 13.113299999999999, "mc": 0.0}], "name": "SER", "chain": "A", "cv_coarse": [0.49665736696904217], "number": 235, "sap_score": [-0.10508123854630803], "cv_fine": [0.885826486925949], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 4.06, "total": 4.634, "mc": 0.574}], "id": "A.235. "}, {"ins_code": " ", "sesa": [{"sc": 32.376400000000004, "total": 32.376400000000004, "mc": 0.0}], "name": "VAL", "chain": "A", "cv_coarse": [0.36851890688788214], "number": 237, "sap_score": [0.15006212684359013], "cv_fine": [0.8104935319585451], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 20.443, "total": 20.716, "mc": 0.273}], "id": "A.237. "}, {"ins_code": " ", "sesa": [{"sc": 24.430799999999998, "total": 27.1291, "mc": 2.6983}], "name": "VAL", "chain": "A", "cv_coarse": [0.30873744970033], "number": 238, "sap_score": [0.26253961165816037], "cv_fine": [0.8573724697690294], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 11.402, "total": 11.893, "mc": 0.491}], "id": "A.238. "}, {"ins_code": " ", "sesa": [{"sc": 53.555, "total": 66.2004, "mc": 12.6454}], "name": "PRO", "chain": "A", "cv_coarse": [0.251476356917028], "number": 239, "sap_score": [0.6626569572723792], "cv_fine": [0.7224152658382267], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 55.865, "total": 60.567, "mc": 4.701}], "id": "A.239. "}, {"ins_code": " ", "sesa": [{"sc": 27.169000000000004, "total": 44.2438, "mc": 17.0748}], "name": "TYR", "chain": "A", "cv_coarse": [0.23960470425142422], "number": 240, "sap_score": [0.5817499497511334], "cv_fine": [0.8173814242284184], "name_short": "Y", "surface": [true], "secondary_structure": ["L"], "chemical_name": "TYROSINE", "fasa": [{"sc": 9.968, "total": 29.883, "mc": 19.915}], "id": "A.240. "}, {"ins_code": " ", "sesa": [{"sc": 66.5649, "total": 72.6285, "mc": 6.0636}], "name": "GLU", "chain": "A", "cv_coarse": [0.18845519440806344], "number": 241, "sap_score": [-1.0012676110686278], "cv_fine": [0.6263176100734749], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 90.35, "total": 91.8, "mc": 1.449}], "id": "A.241. "}, {"ins_code": " ", "sesa": [{"sc": 49.7357, "total": 49.7357, "mc": 0.0}], "name": "PRO", "chain": "A", "cv_coarse": [0.16994296968592204], "number": 242, "sap_score": [-0.44562124701460365], "cv_fine": [0.6444278935817044], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 62.802, "total": 62.802, "mc": 0.0}], "id": "A.242. "}, {"ins_code": " ", "sesa": [{"sc": 25.9135, "total": 41.6442, "mc": 15.7307}], "name": "PRO", "chain": "A", "cv_coarse": [0.16441225812802188], "number": 243, "sap_score": [-0.43198470941859735], "cv_fine": [0.7345795348604691], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 21.688, "total": 35.008, "mc": 13.319}], "id": "A.243. "}, {"ins_code": " ", "sesa": [{"sc": 84.29199999999999, "total": 100.2083, "mc": 15.9163}], "name": "GLN", "chain": "A", "cv_coarse": [0.12300434716488932], "number": 244, "sap_score": [-0.7890989240790784], "cv_fine": [0.4297265103116916], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 135.435, "total": 139.399, "mc": 3.964}], "id": "A.244. "}, {"ins_code": " ", "sesa": [{"sc": 69.453, "total": 86.91460000000001, "mc": 17.4616}], "name": "VAL", "chain": "A", "cv_coarse": [0.0983427008534538], "number": 245, "sap_score": [0.9324129645883567], "cv_fine": [0.3130051055934766], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 124.179, "total": 141.528, "mc": 17.348}], "id": "A.245. "}, {"ins_code": " ", "sesa": [{"sc": 20.7185, "total": 49.381, "mc": 28.6625}], "name": "GLY", "chain": "A", "cv_coarse": [0.10646046607646817], "number": 246, "sap_score": [0.5468127473180641], "cv_fine": [0.3231473088427222], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 37.244, "total": 84.14, "mc": 46.896}], "id": "A.246. "}, {"ins_code": " ", "sesa": [{"sc": 43.8932, "total": 59.3472, "mc": 15.454}], "name": "THR", "chain": "A", "cv_coarse": [0.13595517817585234], "number": 247, "sap_score": [-1.0496757233902398], "cv_fine": [0.5122926909782307], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 55.595, "total": 70.578, "mc": 14.984}], "id": "A.247. "}, {"ins_code": " ", "sesa": [{"sc": 55.0389, "total": 72.4737, "mc": 17.4348}], "name": "GLU", "chain": "A", "cv_coarse": [0.17826433837339228], "number": 248, "sap_score": [-1.705372571658726], "cv_fine": [0.53984621518356], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 79.398, "total": 88.702, "mc": 9.304}], "id": "A.248. "}, {"ins_code": " ", "sesa": [{"sc": 50.5188, "total": 61.085300000000004, "mc": 10.5665}], "name": "PHE", "chain": "A", "cv_coarse": [0.200764209438534], "number": 249, "sap_score": [-0.10678101752879474], "cv_fine": [0.6772825521191345], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 59.604, "total": 63.737, "mc": 4.133}], "id": "A.249. "}, {"ins_code": " ", "sesa": [{"sc": 34.4275, "total": 34.4275, "mc": 0.0}], "name": "THR", "chain": "A", "cv_coarse": [0.23394127137038076], "number": 250, "sap_score": [-0.231432579435186], "cv_fine": [0.8211041555271926], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 21.422, "total": 21.422, "mc": 0.0}], "id": "A.250. "}, {"ins_code": " ", "sesa": [{"sc": 52.2285, "total": 74.2409, "mc": 22.0124}], "name": "THR", "chain": "A", "cv_coarse": [0.2303589598692664], "number": 251, "sap_score": [0.0920223513538838], "cv_fine": [0.700894192701579], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 57.863, "total": 80.426, "mc": 22.564}], "id": "A.251. "}, {"ins_code": " ", "sesa": [{"sc": 25.677, "total": 25.677, "mc": 0.0}], "name": "ILE", "chain": "A", "cv_coarse": [0.31269888674794083], "number": 252, "sap_score": [0.6258795203016405], "cv_fine": [0.8847560475667782], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 15.195, "total": 15.195, "mc": 0.0}], "id": "A.252. "}, {"ins_code": " ", "sesa": [{"sc": 45.8428, "total": 50.407300000000006, "mc": 4.5645}], "name": "LEU", "chain": "A", "cv_coarse": [0.26460442872634904], "number": 253, "sap_score": [0.7348007437620447], "cv_fine": [0.6831926272581088], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 56.143, "total": 57.042, "mc": 0.899}], "id": "A.253. "}, {"ins_code": " ", "sesa": [{"sc": 28.6884, "total": 28.6884, "mc": 0.0}], "name": "ASN", "chain": "A", "cv_coarse": [0.3321023607822726], "number": 255, "sap_score": [-0.41345703160076797], "cv_fine": [0.8654999491818], "name_short": "N", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 13.898, "total": 13.898, "mc": 0.0}], "id": "A.255. "}, {"ins_code": " ", "sesa": [{"sc": 17.9129, "total": 26.871000000000002, "mc": 8.9581}], "name": "MET", "chain": "A", "cv_coarse": [0.35951856171723207], "number": 257, "sap_score": [0.20092535996783978], "cv_fine": [0.9073559463074834], "name_short": "M", "surface": [true], "secondary_structure": ["L"], "chemical_name": "METHIONINE", "fasa": [{"sc": 4.243, "total": 6.338, "mc": 2.095}], "id": "A.257. "}, {"ins_code": " ", "sesa": [{"sc": 35.0496, "total": 35.0496, "mc": 0.0}], "name": "ASN", "chain": "A", "cv_coarse": [0.3785823575682986], "number": 259, "sap_score": [0.33072603913932935], "cv_fine": [0.7659745892916914], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 26.319, "total": 26.319, "mc": 0.0}], "id": "A.259. "}, {"ins_code": " ", "sesa": [{"sc": 25.955199999999998, "total": 28.3876, "mc": 2.4324}], "name": "SER", "chain": "A", "cv_coarse": [0.468358826625221], "number": 260, "sap_score": [-0.23974558966780357], "cv_fine": [0.8449690404346498], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 8.12, "total": 8.301, "mc": 0.181}], "id": "A.260. "}, {"ins_code": " ", "sesa": [{"sc": 39.004, "total": 53.4435, "mc": 14.439499999999999}], "name": "SER", "chain": "A", "cv_coarse": [0.3708659176223412], "number": 261, "sap_score": [-0.4865068886231043], "cv_fine": [0.6036890244038537], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 45.915, "total": 52.367, "mc": 6.452}], "id": "A.261. "}, {"ins_code": " ", "sesa": [{"sc": 20.768700000000003, "total": 20.768700000000003, "mc": 0.0}], "name": "CYS", "chain": "A", "cv_coarse": [0.38258254251539275], "number": 262, "sap_score": [0.3512912442898449], "cv_fine": [0.7055906229393744], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 15.084, "total": 15.141, "mc": 0.057}], "id": "A.262. "}, {"ins_code": " ", "sesa": [{"sc": 64.54990000000001, "total": 78.5767, "mc": 14.026800000000001}], "name": "VAL", "chain": "A", "cv_coarse": [0.337219234086204], "number": 263, "sap_score": [0.6603544297234439], "cv_fine": [0.4706821217454998], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 62.088, "total": 64.785, "mc": 2.697}], "id": "A.263. "}, {"ins_code": " ", "sesa": [{"sc": 18.1355, "total": 40.335, "mc": 22.1995}], "name": "GLY", "chain": "A", "cv_coarse": [0.40365181338297124], "number": 264, "sap_score": [0.401867025956072], "cv_fine": [0.5158339857571583], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 21.365, "total": 51.642, "mc": 30.277}], "id": "A.264. "}, {"ins_code": " ", "sesa": [{"sc": 10.0642, "total": 21.692700000000002, "mc": 11.628499999999999}], "name": "GLY", "chain": "A", "cv_coarse": [0.47386960843212345], "number": 265, "sap_score": [-0.14737214431630866], "cv_fine": [0.7191261298295895], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 7.123, "total": 9.294, "mc": 2.171}], "id": "A.265. "}, {"ins_code": " ", "sesa": [{"sc": 48.090999999999994, "total": 54.911699999999996, "mc": 6.8207}], "name": "ASN", "chain": "A", "cv_coarse": [0.4467869233528367], "number": 267, "sap_score": [-1.0834856915712732], "cv_fine": [0.558577985705446], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 63.323, "total": 67.78, "mc": 4.458}], "id": "A.267. "}, {"ins_code": " ", "sesa": [{"sc": 96.14340000000001, "total": 117.833, "mc": 21.6896}], "name": "ARG", "chain": "A", "cv_coarse": [0.4134427166262835], "number": 268, "sap_score": [-3.0296719527539606], "cv_fine": [0.42907716178760674], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 142.627, "total": 166.193, "mc": 23.566}], "id": "A.268. "}, {"ins_code": " ", "sesa": [{"sc": 53.772800000000004, "total": 56.766999999999996, "mc": 2.9942}], "name": "ARG", "chain": "A", "cv_coarse": [0.5828168425342155], "number": 269, "sap_score": [-1.0707980548593201], "cv_fine": [0.7076684371653635], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 45.821, "total": 45.821, "mc": 0.0}], "id": "A.269. "}, {"ins_code": " ", "sesa": [{"sc": 61.00280000000001, "total": 67.9248, "mc": 6.922}], "name": "PRO", "chain": "A", "cv_coarse": [0.6153293638862669], "number": 270, "sap_score": [0.006102575220488215], "cv_fine": [0.6986985902192357], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 55.295, "total": 55.687, "mc": 0.392}], "id": "A.270. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 6.4861, "mc": 6.4861}], "name": "ILE", "chain": "A", "cv_coarse": [0.6575454044620729], "number": 271, "sap_score": [0.25394970865584865], "cv_fine": [0.944003821199606], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 0.031, "total": 0.032, "mc": 0.001}], "id": "A.271. "}, {"ins_code": " ", "sesa": [{"sc": 34.3964, "total": 34.3964, "mc": 0.0}], "name": "LEU", "chain": "A", "cv_coarse": [0.7230070269224469], "number": 272, "sap_score": [-0.37323809679422043], "cv_fine": [0.8584216427754672], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 8.158, "total": 8.158, "mc": 0.0}], "id": "A.272. "}, {"ins_code": " ", "sesa": [{"sc": 31.468000000000004, "total": 31.468000000000004, "mc": 0.0}], "name": "ILE", "chain": "A", "cv_coarse": [0.6586533309002698], "number": 274, "sap_score": [0.06063236454981323], "cv_fine": [0.9283639983205606], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 5.566, "total": 5.566, "mc": 0.0}], "id": "A.274. "}, {"ins_code": " ", "sesa": [{"sc": 16.8521, "total": 16.8521, "mc": 0.0}], "name": "THR", "chain": "A", "cv_coarse": [0.511369226626831], "number": 276, "sap_score": [0.01888087365620948], "cv_fine": [0.9172360911420141], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 6.724, "total": 6.724, "mc": 0.0}], "id": "A.276. "}, {"ins_code": " ", "sesa": [{"sc": 35.7362, "total": 38.0236, "mc": 2.2874}], "name": "GLU", "chain": "A", "cv_coarse": [0.4000125994208656], "number": 278, "sap_score": [-0.6415815746109189], "cv_fine": [0.8022606928042595], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 20.133, "total": 20.152, "mc": 0.018}], "id": "A.278. "}, {"ins_code": " ", "sesa": [{"sc": 52.3651, "total": 60.9608, "mc": 8.595699999999999}], "name": "MET", "chain": "A", "cv_coarse": [0.28845469491082415], "number": 279, "sap_score": [-0.11711323116853176], "cv_fine": [0.6669985471283221], "name_short": "M", "surface": [true], "secondary_structure": ["L"], "chemical_name": "METHIONINE", "fasa": [{"sc": 52.963, "total": 55.447, "mc": 2.484}], "id": "A.279. "}, {"ins_code": " ", "sesa": [{"sc": 99.6337, "total": 121.5344, "mc": 21.9007}], "name": "ARG", "chain": "A", "cv_coarse": [0.2391082827086994], "number": 280, "sap_score": [-3.3923369274948385], "cv_fine": [0.4209850547816958], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 142.889, "total": 174.348, "mc": 31.46}], "id": "A.280. "}, {"ins_code": " ", "sesa": [{"sc": 55.5378, "total": 77.6399, "mc": 22.1021}], "name": "ASP", "chain": "A", "cv_coarse": [0.2925005859218199], "number": 281, "sap_score": [-3.876563442541527], "cv_fine": [0.3747430867830417], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 84.028, "total": 118.272, "mc": 34.244}], "id": "A.281. "}, {"ins_code": " ", "sesa": [{"sc": 14.0791, "total": 30.0831, "mc": 16.003999999999998}], "name": "GLY", "chain": "A", "cv_coarse": [0.3783737117178746], "number": 282, "sap_score": [-2.490421781325516], "cv_fine": [0.5177402147471675], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 18.443, "total": 33.964, "mc": 15.521}], "id": "A.282. "}, {"ins_code": " ", "sesa": [{"sc": 80.7549, "total": 85.7765, "mc": 5.0216}], "name": "GLN", "chain": "A", "cv_coarse": [0.34392822101777715], "number": 283, "sap_score": [-1.1808333030962526], "cv_fine": [0.4519364725412476], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 128.764, "total": 130.577, "mc": 1.813}], "id": "A.283. "}, {"ins_code": " ", "sesa": [{"sc": 36.1159, "total": 58.525800000000004, "mc": 22.4099}], "name": "VAL", "chain": "A", "cv_coarse": [0.4314070994762637], "number": 284, "sap_score": [1.4034548754122855], "cv_fine": [0.7058692196477958], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 40.966, "total": 61.75, "mc": 20.784}], "id": "A.284. "}, {"ins_code": " ", "sesa": [{"sc": 32.6127, "total": 35.6215, "mc": 3.0088}], "name": "LEU", "chain": "A", "cv_coarse": [0.3391942908896582], "number": 285, "sap_score": [1.3894665633606502], "cv_fine": [0.752430581909791], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 20.156, "total": 21.074, "mc": 0.919}], "id": "A.285. "}, {"ins_code": " ", "sesa": [{"sc": 32.8389, "total": 32.8389, "mc": 0.0}], "name": "ARG", "chain": "A", "cv_coarse": [0.5508937486963333], "number": 287, "sap_score": [-0.5731605264095072], "cv_fine": [0.8513789713452211], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 21.877, "total": 21.877, "mc": 0.0}], "id": "A.287. "}, {"ins_code": " ", "sesa": [{"sc": 42.2502, "total": 42.2502, "mc": 0.0}], "name": "ARG", "chain": "A", "cv_coarse": [0.46576334581408785], "number": 288, "sap_score": [-0.5620376193377352], "cv_fine": [0.7793939648468607], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 31.969, "total": 32.086, "mc": 0.117}], "id": "A.288. "}, {"ins_code": " ", "sesa": [{"sc": 10.4068, "total": 16.7517, "mc": 6.3449}], "name": "SER", "chain": "A", "cv_coarse": [0.5822426863962468], "number": 289, "sap_score": [-0.34673328006931314], "cv_fine": [0.8454918843699022], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 3.849, "total": 6.401, "mc": 2.552}], "id": "A.289. "}, {"ins_code": " ", "sesa": [{"sc": 14.753499999999999, "total": 15.862400000000001, "mc": 1.1089}], "name": "PHE", "chain": "A", "cv_coarse": [0.5540457149581388], "number": 290, "sap_score": [0.20056776462204814], "cv_fine": [0.9332537286219708], "name_short": "F", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 7.058, "total": 7.209, "mc": 0.151}], "id": "A.290. "}, {"ins_code": " ", "sesa": [{"sc": 51.169799999999995, "total": 55.433099999999996, "mc": 4.2633}], "name": "GLU", "chain": "A", "cv_coarse": [0.5682371385641596], "number": 291, "sap_score": [-0.2879517970404775], "cv_fine": [0.7493951409198518], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 36.245, "total": 37.865, "mc": 1.62}], "id": "A.291. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 11.8988, "mc": 11.8988}], "name": "GLY", "chain": "A", "cv_coarse": [0.5697507263775667], "number": 292, "sap_score": [-0.15825006858746615], "cv_fine": [0.9510402414719975], "name_short": "G", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLYCINE", "fasa": [{"sc": 3.164, "total": 4.315, "mc": 1.15}], "id": "A.292. "}, {"ins_code": " ", "sesa": [{"sc": 71.51570000000001, "total": 71.51570000000001, "mc": 0.0}], "name": "ARG", "chain": "A", "cv_coarse": [0.4339148367579924], "number": 293, "sap_score": [-0.9550928730152156], "cv_fine": [0.798135971272048], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 87.243, "total": 87.597, "mc": 0.353}], "id": "A.293. "}, {"ins_code": " ", "sesa": [{"sc": 23.3561, "total": 26.0432, "mc": 2.6871}], "name": "CYS", "chain": "A", "cv_coarse": [0.3338664472888356], "number": 295, "sap_score": [-0.14326264664459795], "cv_fine": [0.7498493759371017], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 8.909, "total": 8.911, "mc": 0.002}], "id": "A.295. "}, {"ins_code": " ", "sesa": [{"sc": 40.833099999999995, "total": 59.2588, "mc": 18.4257}], "name": "ALA", "chain": "A", "cv_coarse": [0.25478768645272154], "number": 296, "sap_score": [0.3880443488706952], "cv_fine": [0.49918355619950283], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 63.179, "total": 75.854, "mc": 12.676}], "id": "A.296. "}, {"ins_code": " ", "sesa": [{"sc": 41.368399999999994, "total": 46.7136, "mc": 5.3452}], "name": "CYS", "chain": "A", "cv_coarse": [0.2434568687610578], "number": 297, "sap_score": [-0.503845183665509], "cv_fine": [0.5645736764676766], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 48.88, "total": 49.495, "mc": 0.615}], "id": "A.297. "}, {"ins_code": " ", "sesa": [{"sc": 7.4786, "total": 7.4786, "mc": 0.0}], "name": "PRO", "chain": "A", "cv_coarse": [0.2744913319707795], "number": 298, "sap_score": [-0.03175557930500633], "cv_fine": [0.8313637199738528], "name_short": "P", "surface": [true], "secondary_structure": ["H"], "chemical_name": "PROLINE", "fasa": [{"sc": 1.515, "total": 1.515, "mc": 0.0}], "id": "A.298. "}, {"ins_code": " ", "sesa": [{"sc": 11.0742, "total": 22.9956, "mc": 11.921399999999998}], "name": "GLY", "chain": "A", "cv_coarse": [0.2332480617918986], "number": 299, "sap_score": [-0.6596915996498517], "cv_fine": [0.7486168369954866], "name_short": "G", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLYCINE", "fasa": [{"sc": 4.704, "total": 9.305, "mc": 4.601}], "id": "A.299. "}, {"ins_code": " ", "sesa": [{"sc": 92.3629, "total": 101.4997, "mc": 9.136800000000001}], "name": "ARG", "chain": "A", "cv_coarse": [0.22077146542706333], "number": 300, "sap_score": [-1.9649591902641383], "cv_fine": [0.46385469146949104], "name_short": "R", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ARGININE", "fasa": [{"sc": 127.724, "total": 129.509, "mc": 1.785}], "id": "A.300. "}, {"ins_code": " ", "sesa": [{"sc": 30.640700000000002, "total": 34.1397, "mc": 3.499}], "name": "ASP", "chain": "A", "cv_coarse": [0.2962783158019167], "number": 301, "sap_score": [-1.283908530826963], "cv_fine": [0.6843083252008378], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 16.975, "total": 17.25, "mc": 0.275}], "id": "A.301. "}, {"ins_code": " ", "sesa": [{"sc": 54.914699999999996, "total": 54.914699999999996, "mc": 0.0}], "name": "ARG", "chain": "A", "cv_coarse": [0.2840288972452198], "number": 302, "sap_score": [-0.8091353467632747], "cv_fine": [0.7798343968287811], "name_short": "R", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ARGININE", "fasa": [{"sc": 47.297, "total": 47.297, "mc": 0.0}], "id": "A.302. "}, {"ins_code": " ", "sesa": [{"sc": 90.8121, "total": 95.13080000000001, "mc": 4.3187}], "name": "LYS", "chain": "A", "cv_coarse": [0.21304242913704396], "number": 303, "sap_score": [-1.1195214697105802], "cv_fine": [0.5562256882517391], "name_short": "K", "surface": [true], "secondary_structure": ["H"], "chemical_name": "LYSINE", "fasa": [{"sc": 125.865, "total": 126.062, "mc": 0.197}], "id": "A.303. "}, {"ins_code": " ", "sesa": [{"sc": 35.0379, "total": 46.0136, "mc": 10.9757}], "name": "ALA", "chain": "A", "cv_coarse": [0.2657248524784852], "number": 304, "sap_score": [-1.585411514685923], "cv_fine": [0.6182231871230263], "name_short": "A", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ALANINE", "fasa": [{"sc": 48.695, "total": 54.213, "mc": 5.518}], "id": "A.304. "}, {"ins_code": " ", "sesa": [{"sc": 44.4785, "total": 51.848, "mc": 7.3695}], "name": "ASP", "chain": "A", "cv_coarse": [0.34137486009901014], "number": 305, "sap_score": [-0.9618616488100251], "cv_fine": [0.680274652626139], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 44.481, "total": 46.677, "mc": 2.196}], "id": "A.305. "}, {"ins_code": " ", "sesa": [{"sc": 38.9204, "total": 45.824600000000004, "mc": 6.9041999999999994}], "name": "GLU", "chain": "A", "cv_coarse": [0.2718181039231563], "number": 306, "sap_score": [-1.2927386698382204], "cv_fine": [0.7278073424551279], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 42.131, "total": 43.992, "mc": 1.86}], "id": "A.306. "}, {"ins_code": " ", "sesa": [{"sc": 56.5537, "total": 68.5997, "mc": 12.046000000000001}], "name": "ASP", "chain": "A", "cv_coarse": [0.22502088553127486], "number": 307, "sap_score": [-2.4798781127779104], "cv_fine": [0.5004424141530668], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 82.576, "total": 95.229, "mc": 12.653}], "id": "A.307. "}, {"ins_code": " ", "sesa": [{"sc": 83.61040000000001, "total": 96.42320000000001, "mc": 12.8128}], "name": "HIS", "chain": "A", "cv_coarse": [0.2950023134445907], "number": 308, "sap_score": [-2.309795423254718], "cv_fine": [0.368292151901615], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 145.136, "total": 153.654, "mc": 8.519}], "id": "A.308. "}, {"ins_code": " ", "sesa": [{"sc": 62.1232, "total": 80.2134, "mc": 18.0902}], "name": "TYR", "chain": "A", "cv_coarse": [0.28100239607123756], "number": 309, "sap_score": [-1.27923063168416], "cv_fine": [0.5089551642525221], "name_short": "Y", "surface": [true], "secondary_structure": ["H"], "chemical_name": "TYROSINE", "fasa": [{"sc": 64.461, "total": 91.038, "mc": 26.577}], "id": "A.309. "}, {"ins_code": " ", "sesa": [{"sc": 96.97699999999999, "total": 126.26839999999999, "mc": 29.291400000000003}], "name": "ARG", "chain": "A", "cv_coarse": [0.22098409654292359], "number": 310, "sap_score": [-3.048746192548342], "cv_fine": [0.29995970669065347], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 159.751, "total": 218.888, "mc": 59.136}], "id": "A.310. "}, {"ins_code": " ", "sesa": [{"sc": 40.8641, "total": 79.5509, "mc": 38.686800000000005}], "name": "GLU", "chain": "B", "cv_coarse": [0.16083999124163145], "number": 113, "sap_score": [-5.514193868995479], "cv_fine": [0.46834443066495385], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 85.146, "total": 139.153, "mc": 54.007}], "id": "B.113. "}, {"ins_code": " ", "sesa": [{"sc": 31.0945, "total": 52.1402, "mc": 21.0457}], "name": "PHE", "chain": "B", "cv_coarse": [0.14830122688649455], "number": 114, "sap_score": [-2.159051164750041], "cv_fine": [0.5312958415199367], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 52.863, "total": 61.286, "mc": 8.423}], "id": "B.114. "}, {"ins_code": " ", "sesa": [{"sc": 79.9901, "total": 99.70790000000001, "mc": 19.7178}], "name": "ILE", "chain": "B", "cv_coarse": [0.1502695643658247], "number": 115, "sap_score": [1.3027660501445972], "cv_fine": [0.5230078818891568], "name_short": "I", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 112.735, "total": 128.095, "mc": 15.36}], "id": "B.115. "}, {"ins_code": " ", "sesa": [{"sc": 47.6783, "total": 63.9556, "mc": 16.2773}], "name": "PRO", "chain": "B", "cv_coarse": [0.20787500488409588], "number": 116, "sap_score": [0.8359522897143906], "cv_fine": [0.7247138499538188], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 18.78, "total": 30.095, "mc": 11.315}], "id": "B.116. "}, {"ins_code": " ", "sesa": [{"sc": 36.8633, "total": 56.4294, "mc": 19.5661}], "name": "SER", "chain": "B", "cv_coarse": [0.20677547456400056], "number": 117, "sap_score": [-0.422968274586694], "cv_fine": [0.6396297436827569], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 54.293, "total": 60.423, "mc": 6.131}], "id": "B.117. "}, {"ins_code": " ", "sesa": [{"sc": 54.7587, "total": 75.0606, "mc": 20.3019}], "name": "ASN", "chain": "B", "cv_coarse": [0.22125970222957803], "number": 118, "sap_score": [-0.911411445033897], "cv_fine": [0.5922804848086229], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 78.219, "total": 88.587, "mc": 10.367}], "id": "B.118. "}, {"ins_code": " ", "sesa": [{"sc": 56.6205, "total": 57.0019, "mc": 0.3814}], "name": "THR", "chain": "B", "cv_coarse": [0.21024335828021762], "number": 119, "sap_score": [-1.2559016753659606], "cv_fine": [0.47455075092418486], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 89.563, "total": 89.577, "mc": 0.014}], "id": "B.119. "}, {"ins_code": " ", "sesa": [{"sc": 40.3334, "total": 59.5214, "mc": 19.188}], "name": "ASP", "chain": "B", "cv_coarse": [0.25053080362021196], "number": 120, "sap_score": [-1.54111610012922], "cv_fine": [0.5353388185287076], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 49.508, "total": 67.879, "mc": 18.371}], "id": "B.120. "}, {"ins_code": " ", "sesa": [{"sc": 71.05539999999999, "total": 71.05539999999999, "mc": 0.0}], "name": "TYR", "chain": "B", "cv_coarse": [0.21612555587355672], "number": 121, "sap_score": [1.179079226187796], "cv_fine": [0.5357426451626035], "name_short": "Y", "surface": [true], "secondary_structure": ["L"], "chemical_name": "TYROSINE", "fasa": [{"sc": 91.523, "total": 91.523, "mc": 0.0}], "id": "B.121. "}, {"ins_code": " ", "sesa": [{"sc": 48.0646, "total": 48.0646, "mc": 0.0}], "name": "PRO", "chain": "B", "cv_coarse": [0.24461656220311298], "number": 122, "sap_score": [0.24468164896526956], "cv_fine": [0.5605287545996607], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 67.549, "total": 67.549, "mc": 0.0}], "id": "B.122. "}, {"ins_code": " ", "sesa": [{"sc": 5.8151, "total": 23.9642, "mc": 18.1491}], "name": "GLY", "chain": "B", "cv_coarse": [0.2188806034180363], "number": 123, "sap_score": [1.5180964645652333], "cv_fine": [0.5158106842401633], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 5.236, "total": 22.306, "mc": 17.07}], "id": "B.123. "}, {"ins_code": " ", "sesa": [{"sc": 58.777899999999995, "total": 77.91209999999998, "mc": 19.1342}], "name": "PRO", "chain": "B", "cv_coarse": [0.19918267175479093], "number": 124, "sap_score": [1.1512140178594037], "cv_fine": [0.41360616687515683], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 85.438, "total": 112.397, "mc": 26.959}], "id": "B.124. "}, {"ins_code": " ", "sesa": [{"sc": 45.6741, "total": 45.6741, "mc": 0.0}], "name": "HIS", "chain": "B", "cv_coarse": [0.2436777765602096], "number": 125, "sap_score": [-0.2549023349785678], "cv_fine": [0.6135948797366094], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 54.865, "total": 54.922, "mc": 0.058}], "id": "B.125. "}, {"ins_code": " ", "sesa": [{"sc": 47.098600000000005, "total": 51.361700000000006, "mc": 4.2631}], "name": "HIS", "chain": "B", "cv_coarse": [0.2872670791810264], "number": 126, "sap_score": [-0.9812004404765711], "cv_fine": [0.6150157710038975], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 52.386, "total": 54.137, "mc": 1.751}], "id": "B.126. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 9.3223, "mc": 9.3223}], "name": "PHE", "chain": "B", "cv_coarse": [0.3705708388388789], "number": 127, "sap_score": [-0.3549706967235611], "cv_fine": [0.8666567647407994], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 1.068, "total": 2.852, "mc": 1.785}], "id": "B.127. "}, {"ins_code": " ", "sesa": [{"sc": 49.489000000000004, "total": 49.489000000000004, "mc": 0.0}], "name": "GLU", "chain": "B", "cv_coarse": [0.37343380221617584], "number": 128, "sap_score": [-1.0599739320984136], "cv_fine": [0.6702144193177884], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 53.852, "total": 53.852, "mc": 0.0}], "id": "B.128. "}, {"ins_code": " ", "sesa": [{"sc": 12.2871, "total": 31.171799999999998, "mc": 18.8847}], "name": "VAL", "chain": "B", "cv_coarse": [0.46526438759943733], "number": 129, "sap_score": [0.33863425967081606], "cv_fine": [0.8478116921110581], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 4.159, "total": 19.672, "mc": 15.513}], "id": "B.129. "}, {"ins_code": " ", "sesa": [{"sc": 53.3852, "total": 55.6593, "mc": 2.2741}], "name": "THR", "chain": "B", "cv_coarse": [0.49456092992553274], "number": 130, "sap_score": [0.5371028678567838], "cv_fine": [0.6941129012397819], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 62.702, "total": 62.702, "mc": 0.0}], "id": "B.130. "}, {"ins_code": " ", "sesa": [{"sc": 34.6596, "total": 50.08310000000001, "mc": 15.4235}], "name": "PHE", "chain": "B", "cv_coarse": [0.5308674614481602], "number": 131, "sap_score": [0.2346343852362783], "cv_fine": [0.7953804541759442], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 19.222, "total": 33.607, "mc": 14.384}], "id": "B.131. "}, {"ins_code": " ", "sesa": [{"sc": 55.3447, "total": 61.013400000000004, "mc": 5.668699999999999}], "name": "GLN", "chain": "B", "cv_coarse": [0.6141599319426103], "number": 132, "sap_score": [-0.9767144137674687], "cv_fine": [0.6538985905856949], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 59.055, "total": 60.45, "mc": 1.395}], "id": "B.132. "}, {"ins_code": " ", "sesa": [{"sc": 83.2769, "total": 103.01849999999999, "mc": 19.7416}], "name": "GLN", "chain": "B", "cv_coarse": [0.49536640477989535], "number": 133, "sap_score": [-2.0697933753294455], "cv_fine": [0.4251443830102557], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 155.025, "total": 172.737, "mc": 17.712}], "id": "B.133. "}, {"ins_code": " ", "sesa": [{"sc": 25.3551, "total": 48.50450000000001, "mc": 23.1494}], "name": "SER", "chain": "B", "cv_coarse": [0.508274882429378], "number": 134, "sap_score": [-1.4221861092715418], "cv_fine": [0.6720944090798051], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 14.639, "total": 34.222, "mc": 19.583}], "id": "B.134. "}, {"ins_code": " ", "sesa": [{"sc": 32.6953, "total": 54.0094, "mc": 21.3141}], "name": "SER", "chain": "B", "cv_coarse": [0.4712084208517407], "number": 135, "sap_score": [-0.7186500414997046], "cv_fine": [0.5875625506535879], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 51.751, "total": 60.998, "mc": 9.247}], "id": "B.135. "}, {"ins_code": " ", "sesa": [{"sc": 61.1081, "total": 84.1245, "mc": 23.0164}], "name": "THR", "chain": "B", "cv_coarse": [0.3613943200814455], "number": 136, "sap_score": [-0.42066841873137634], "cv_fine": [0.42828635001632265], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 116.197, "total": 142.133, "mc": 25.936}], "id": "B.136. "}, {"ins_code": " ", "sesa": [{"sc": 33.6121, "total": 44.9298, "mc": 11.317699999999999}], "name": "ALA", "chain": "B", "cv_coarse": [0.3822409290204764], "number": 137, "sap_score": [-0.802663640995373], "cv_fine": [0.4866435922050093], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 47.69, "total": 50.343, "mc": 2.653}], "id": "B.137. "}, {"ins_code": " ", "sesa": [{"sc": 88.2311, "total": 112.434, "mc": 24.2029}], "name": "LYS", "chain": "B", "cv_coarse": [0.31248564538569373], "number": 138, "sap_score": [-1.1556281764251288], "cv_fine": [0.43230351023816904], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 130.827, "total": 150.81, "mc": 19.982}], "id": "B.138. "}, {"ins_code": " ", "sesa": [{"sc": 42.3157, "total": 63.7218, "mc": 21.406100000000002}], "name": "SER", "chain": "B", "cv_coarse": [0.4141396577812582], "number": 139, "sap_score": [-0.750516505048826], "cv_fine": [0.4195142994111734], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 80.319, "total": 99.889, "mc": 19.57}], "id": "B.139. "}, {"ins_code": " ", "sesa": [{"sc": 21.3711, "total": 32.8651, "mc": 11.494}], "name": "ALA", "chain": "B", "cv_coarse": [0.4799695300954731], "number": 140, "sap_score": [-0.5673417890510525], "cv_fine": [0.6542263162967048], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 11.427, "total": 13.695, "mc": 2.267}], "id": "B.140. "}, {"ins_code": " ", "sesa": [{"sc": 37.1032, "total": 44.033300000000004, "mc": 6.9301}], "name": "THR", "chain": "B", "cv_coarse": [0.5614266303086767], "number": 141, "sap_score": [-0.1445657163414294], "cv_fine": [0.7384119921614091], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 38.483, "total": 41.895, "mc": 3.412}], "id": "B.141. "}, {"ins_code": " ", "sesa": [{"sc": 29.614599999999996, "total": 38.240899999999996, "mc": 8.6263}], "name": "TRP", "chain": "B", "cv_coarse": [0.6202653163500298], "number": 142, "sap_score": [0.2203041791787124], "cv_fine": [0.8682604336569689], "name_short": "W", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TRYPTOPHAN", "fasa": [{"sc": 18.063, "total": 19.639, "mc": 1.577}], "id": "B.142. "}, {"ins_code": " ", "sesa": [{"sc": 16.7312, "total": 16.7312, "mc": 0.0}], "name": "THR", "chain": "B", "cv_coarse": [0.48361649783246985], "number": 143, "sap_score": [-0.6447295191713021], "cv_fine": [0.8907375420000746], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 2.513, "total": 2.513, "mc": 0.0}], "id": "B.143. "}, {"ins_code": " ", "sesa": [{"sc": 35.157199999999996, "total": 44.7489, "mc": 9.5917}], "name": "TYR", "chain": "B", "cv_coarse": [0.44160638168890154], "number": 144, "sap_score": [0.41884477101051887], "cv_fine": [0.810832953876829], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 14.909, "total": 19.358, "mc": 4.449}], "id": "B.144. "}, {"ins_code": " ", "sesa": [{"sc": 4.4751, "total": 4.4751, "mc": 0.0}], "name": "SER", "chain": "B", "cv_coarse": [0.35697357132305507], "number": 145, "sap_score": [1.547639287870411], "cv_fine": [0.7265947244431508], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 0.255, "total": 0.255, "mc": 0.0}], "id": "B.145. "}, {"ins_code": " ", "sesa": [{"sc": 54.056200000000004, "total": 67.7049, "mc": 13.6487}], "name": "PRO", "chain": "B", "cv_coarse": [0.3338994195589316], "number": 146, "sap_score": [1.6759799011851453], "cv_fine": [0.47048327101079707], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 80.339, "total": 97.212, "mc": 16.873}], "id": "B.146. "}, {"ins_code": " ", "sesa": [{"sc": 73.14500000000001, "total": 94.0349, "mc": 20.8899}], "name": "LEU", "chain": "B", "cv_coarse": [0.25039969148403574], "number": 147, "sap_score": [2.7877144722740086], "cv_fine": [0.49774477213742274], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 86.684, "total": 111.369, "mc": 24.686}], "id": "B.147. "}, {"ins_code": " ", "sesa": [{"sc": 41.9501, "total": 51.134699999999995, "mc": 9.1846}], "name": "LEU", "chain": "B", "cv_coarse": [0.2727302075910103], "number": 148, "sap_score": [1.7285250839166137], "cv_fine": [0.6685806906364326], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 33.024, "total": 41.115, "mc": 8.091}], "id": "B.148. "}, {"ins_code": " ", "sesa": [{"sc": 68.3014, "total": 68.3014, "mc": 0.0}], "name": "LYS", "chain": "B", "cv_coarse": [0.3289255064019907], "number": 149, "sap_score": [-0.3457291757213687], "cv_fine": [0.6545136141219718], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 79.548, "total": 79.548, "mc": 0.0}], "id": "B.149. "}, {"ins_code": " ", "sesa": [{"sc": 47.0536, "total": 47.0536, "mc": 0.0}], "name": "LYS", "chain": "B", "cv_coarse": [0.3460709633356476], "number": 150, "sap_score": [-0.042380137350116975], "cv_fine": [0.7894372885318264], "name_short": "K", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LYSINE", "fasa": [{"sc": 36.467, "total": 36.467, "mc": 0.0}], "id": "B.150. "}, {"ins_code": " ", "sesa": [{"sc": 12.3025, "total": 12.3025, "mc": 0.0}], "name": "TYR", "chain": "B", "cv_coarse": [0.4053205601665013], "number": 152, "sap_score": [-0.7522282482984369], "cv_fine": [0.9107568116632382], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 0.596, "total": 0.596, "mc": 0.0}], "id": "B.152. "}, {"ins_code": " ", "sesa": [{"sc": 45.453500000000005, "total": 45.453500000000005, "mc": 0.0}], "name": "GLN", "chain": "B", "cv_coarse": [0.48362011549283235], "number": 154, "sap_score": [-0.273235705228031], "cv_fine": [0.6914385789291342], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 46.704, "total": 46.704, "mc": 0.0}], "id": "B.154. "}, {"ins_code": " ", "sesa": [{"sc": 51.94890000000001, "total": 65.637, "mc": 13.688099999999999}], "name": "ILE", "chain": "B", "cv_coarse": [0.4519012004959833], "number": 155, "sap_score": [0.7526588687532113], "cv_fine": [0.702298721121664], "name_short": "I", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 42.604, "total": 52.772, "mc": 10.168}], "id": "B.155. "}, {"ins_code": " ", "sesa": [{"sc": 12.3923, "total": 31.761499999999998, "mc": 19.3692}], "name": "ALA", "chain": "B", "cv_coarse": [0.5461291796151879], "number": 156, "sap_score": [1.2298921266654104], "cv_fine": [0.7291739316233067], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 6.116, "total": 20.308, "mc": 14.191}], "id": "B.156. "}, {"ins_code": " ", "sesa": [{"sc": 53.9885, "total": 53.9885, "mc": 0.0}], "name": "LYS", "chain": "B", "cv_coarse": [0.5837290171751754], "number": 157, "sap_score": [-0.4330835764656656], "cv_fine": [0.6784735370114751], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 76.55, "total": 76.55, "mc": 0.0}], "id": "B.157. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 5.2995, "mc": 5.2995}], "name": "THR", "chain": "B", "cv_coarse": [0.7570995964387869], "number": 158, "sap_score": [-0.20042963376567496], "cv_fine": [0.8880972717690743], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 0.0, "total": 0.143, "mc": 0.143}], "id": "B.158. "}, {"ins_code": " ", "sesa": [{"sc": 17.5576, "total": 17.5576, "mc": 0.0}], "name": "PRO", "chain": "B", "cv_coarse": [0.7695937744704818], "number": 160, "sap_score": [0.24591428626372477], "cv_fine": [0.8937644448299235], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 7.646, "total": 8.299, "mc": 0.653}], "id": "B.160. "}, {"ins_code": " ", "sesa": [{"sc": 26.650499999999997, "total": 30.4265, "mc": 3.776}], "name": "GLN", "chain": "B", "cv_coarse": [0.6208965448063217], "number": 162, "sap_score": [0.5873945332653746], "cv_fine": [0.8689973578176912], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 4.106, "total": 4.115, "mc": 0.009}], "id": "B.162. "}, {"ins_code": " ", "sesa": [{"sc": 10.4669, "total": 12.356000000000002, "mc": 1.8891}], "name": "ILE", "chain": "B", "cv_coarse": [0.5259302419476429], "number": 163, "sap_score": [0.14204368379233145], "cv_fine": [0.9538698453996756], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 1.767, "total": 1.913, "mc": 0.147}], "id": "B.163. "}, {"ins_code": " ", "sesa": [{"sc": 67.8029, "total": 67.8029, "mc": 0.0}], "name": "LYS", "chain": "B", "cv_coarse": [0.42491257041409125], "number": 164, "sap_score": [-1.0151087611593719], "cv_fine": [0.7280079809748161], "name_short": "K", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LYSINE", "fasa": [{"sc": 51.471, "total": 51.471, "mc": 0.0}], "id": "B.164. "}, {"ins_code": " ", "sesa": [{"sc": 9.729099999999999, "total": 39.9736, "mc": 30.244500000000002}], "name": "VAL", "chain": "B", "cv_coarse": [0.3736725877962345], "number": 165, "sap_score": [0.5164048519014208], "cv_fine": [0.794109939779446], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 6.952, "total": 36.153, "mc": 29.202}], "id": "B.165. "}, {"ins_code": " ", "sesa": [{"sc": 40.3236, "total": 54.3911, "mc": 14.0675}], "name": "SER", "chain": "B", "cv_coarse": [0.29664790345093583], "number": 166, "sap_score": [-0.2937739357468514], "cv_fine": [0.43804793428929245], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 65.906, "total": 89.204, "mc": 23.299}], "id": "B.166. "}, {"ins_code": " ", "sesa": [{"sc": 46.4688, "total": 46.4688, "mc": 0.0}], "name": "THR", "chain": "B", "cv_coarse": [0.2633214685585504], "number": 167, "sap_score": [-0.23716337412163008], "cv_fine": [0.5218289876052155], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 65.72, "total": 65.837, "mc": 0.117}], "id": "B.167. "}, {"ins_code": " ", "sesa": [{"sc": 40.4808, "total": 48.5892, "mc": 8.1084}], "name": "PRO", "chain": "B", "cv_coarse": [0.3170248763283014], "number": 168, "sap_score": [0.7967922338546944], "cv_fine": [0.6387330232084656], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 48.12, "total": 52.835, "mc": 4.714}], "id": "B.168. "}, {"ins_code": " ", "sesa": [{"sc": 55.864, "total": 68.73349999999999, "mc": 12.8695}], "name": "PRO", "chain": "B", "cv_coarse": [0.2603330920661188], "number": 169, "sap_score": [1.079833757926004], "cv_fine": [0.46872278101313863], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 84.628, "total": 99.389, "mc": 14.761}], "id": "B.169. "}, {"ins_code": " ", "sesa": [{"sc": 20.326900000000002, "total": 31.996000000000002, "mc": 11.6691}], "name": "PRO", "chain": "B", "cv_coarse": [0.2696102297964568], "number": 170, "sap_score": [0.9742002780753548], "cv_fine": [0.6444166595013483], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 17.469, "total": 26.715, "mc": 9.247}], "id": "B.170. "}, {"ins_code": " ", "sesa": [{"sc": 43.3541, "total": 44.235, "mc": 0.8809}], "name": "PRO", "chain": "B", "cv_coarse": [0.2470285433356729], "number": 171, "sap_score": [0.45760630709287664], "cv_fine": [0.4811539518686387], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 59.706, "total": 59.787, "mc": 0.081}], "id": "B.171. "}, {"ins_code": " ", "sesa": [{"sc": 17.8046, "total": 46.9487, "mc": 29.1441}], "name": "GLY", "chain": "B", "cv_coarse": [0.2946972660369622], "number": 172, "sap_score": [-0.6674241037155372], "cv_fine": [0.5326828783560067], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 28.73, "total": 57.401, "mc": 28.671}], "id": "B.172. "}, {"ins_code": " ", "sesa": [{"sc": 5.3591, "total": 13.084499999999998, "mc": 7.7254}], "name": "THR", "chain": "B", "cv_coarse": [0.3315987078129847], "number": 173, "sap_score": [0.3879628141098208], "cv_fine": [0.807508076987794], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 2.31, "total": 3.811, "mc": 1.502}], "id": "B.173. "}, {"ins_code": " ", "sesa": [{"sc": 24.3758, "total": 28.6475, "mc": 4.2717}], "name": "ALA", "chain": "B", "cv_coarse": [0.37970162205734165], "number": 174, "sap_score": [0.09579863156782108], "cv_fine": [0.8815603142533144], "name_short": "A", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ALANINE", "fasa": [{"sc": 19.366, "total": 19.595, "mc": 0.229}], "id": "B.174. "}, {"ins_code": " ", "sesa": [{"sc": 14.1217, "total": 14.1217, "mc": 0.0}], "name": "ILE", "chain": "B", "cv_coarse": [0.471660107734183], "number": 175, "sap_score": [0.10315103811309942], "cv_fine": [0.9348919877045344], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 4.23, "total": 4.87, "mc": 0.64}], "id": "B.175. "}, {"ins_code": " ", "sesa": [{"sc": 55.2202, "total": 55.2202, "mc": 0.0}], "name": "ARG", "chain": "B", "cv_coarse": [0.3761298754894463], "number": 176, "sap_score": [-0.7229523642303307], "cv_fine": [0.8475236509487182], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 38.586, "total": 38.586, "mc": 0.0}], "id": "B.176. "}, {"ins_code": " ", "sesa": [{"sc": 31.805899999999998, "total": 31.805899999999998, "mc": 0.0}], "name": "MET", "chain": "B", "cv_coarse": [0.3615641170396341], "number": 178, "sap_score": [-0.1489512124659244], "cv_fine": [0.9085836246431414], "name_short": "M", "surface": [true], "secondary_structure": ["S"], "chemical_name": "METHIONINE", "fasa": [{"sc": 21.86, "total": 21.86, "mc": 0.0}], "id": "B.178. "}, {"ins_code": " ", "sesa": [{"sc": 21.4679, "total": 21.4679, "mc": 0.0}], "name": "VAL", "chain": "B", "cv_coarse": [0.29038810752124794], "number": 180, "sap_score": [0.1327213738794366], "cv_fine": [0.9124166723751775], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 6.371, "total": 6.371, "mc": 0.0}], "id": "B.180. "}, {"ins_code": " ", "sesa": [{"sc": 22.099600000000002, "total": 28.3896, "mc": 6.29}], "name": "TYR", "chain": "B", "cv_coarse": [0.23746989608541613], "number": 181, "sap_score": [-0.02075178505290563], "cv_fine": [0.8838230770329446], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 5.0, "total": 6.624, "mc": 1.624}], "id": "B.181. "}, {"ins_code": " ", "sesa": [{"sc": 56.441399999999994, "total": 75.5143, "mc": 19.0729}], "name": "LYS", "chain": "B", "cv_coarse": [0.22057283983544024], "number": 182, "sap_score": [-0.716234096957463], "cv_fine": [0.5992171552496519], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 59.575, "total": 85.709, "mc": 26.134}], "id": "B.182. "}, {"ins_code": " ", "sesa": [{"sc": 97.1568, "total": 104.5771, "mc": 7.4203}], "name": "LYS", "chain": "B", "cv_coarse": [0.16377852969471954], "number": 183, "sap_score": [-0.8824913332119566], "cv_fine": [0.4734697378197341], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 129.431, "total": 129.601, "mc": 0.17}], "id": "B.183. "}, {"ins_code": " ", "sesa": [{"sc": 38.1258, "total": 58.358000000000004, "mc": 20.2322}], "name": "ALA", "chain": "B", "cv_coarse": [0.1315223488055876], "number": 184, "sap_score": [-0.8840084921183472], "cv_fine": [0.41391955752526355], "name_short": "A", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ALANINE", "fasa": [{"sc": 68.523, "total": 79.762, "mc": 11.239}], "id": "B.184. "}, {"ins_code": " ", "sesa": [{"sc": 70.8385, "total": 89.20179999999999, "mc": 18.3633}], "name": "GLU", "chain": "B", "cv_coarse": [0.11151399943050899], "number": 185, "sap_score": [-2.456461246990714], "cv_fine": [0.34909371430935326], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 117.91, "total": 131.66, "mc": 13.749}], "id": "B.185. "}, {"ins_code": " ", "sesa": [{"sc": 53.021, "total": 55.1363, "mc": 2.1153}], "name": "HIS", "chain": "B", "cv_coarse": [0.15185455694396052], "number": 186, "sap_score": [-2.009463309069546], "cv_fine": [0.5913967721744915], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 60.935, "total": 60.937, "mc": 0.002}], "id": "B.186. "}, {"ins_code": " ", "sesa": [{"sc": 47.9975, "total": 51.477000000000004, "mc": 3.4795000000000003}], "name": "VAL", "chain": "B", "cv_coarse": [0.1696917115963656], "number": 187, "sap_score": [0.026966815232506464], "cv_fine": [0.6973530575064518], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 36.199, "total": 36.688, "mc": 0.489}], "id": "B.187. "}, {"ins_code": " ", "sesa": [{"sc": 57.9272, "total": 77.3358, "mc": 19.4086}], "name": "THR", "chain": "B", "cv_coarse": [0.13673823806189728], "number": 188, "sap_score": [-0.6668896220709994], "cv_fine": [0.4844342953963506], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 91.113, "total": 115.238, "mc": 24.125}], "id": "B.188. "}, {"ins_code": " ", "sesa": [{"sc": 52.407399999999996, "total": 55.4075, "mc": 3.0001}], "name": "ASP", "chain": "B", "cv_coarse": [0.16473671108423735], "number": 189, "sap_score": [-1.1732904123179655], "cv_fine": [0.5610322942763828], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 69.141, "total": 69.209, "mc": 0.068}], "id": "B.189. "}, {"ins_code": " ", "sesa": [{"sc": 51.0301, "total": 68.10900000000001, "mc": 17.0789}], "name": "VAL", "chain": "B", "cv_coarse": [0.20575539621434893], "number": 190, "sap_score": [0.6173808556809469], "cv_fine": [0.6339656708218889], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 59.483, "total": 71.471, "mc": 11.988}], "id": "B.190. "}, {"ins_code": " ", "sesa": [{"sc": 44.7825, "total": 55.435599999999994, "mc": 10.6531}], "name": "LYS", "chain": "B", "cv_coarse": [0.2731678968851507], "number": 192, "sap_score": [-0.26497393945181935], "cv_fine": [0.762641396809318], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 39.134, "total": 41.892, "mc": 2.758}], "id": "B.192. "}, {"ins_code": " ", "sesa": [{"sc": 15.5016, "total": 30.4956, "mc": 14.994}], "name": "ARG", "chain": "B", "cv_coarse": [0.3311709172199676], "number": 193, "sap_score": [-0.37813765847173625], "cv_fine": [0.8824896287023318], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 5.302, "total": 14.351, "mc": 9.049}], "id": "B.193. "}, {"ins_code": " ", "sesa": [{"sc": 14.504199999999999, "total": 14.504199999999999, "mc": 0.0}], "name": "CYS", "chain": "B", "cv_coarse": [0.248631971406685], "number": 194, "sap_score": [0.0912577494745149], "cv_fine": [0.7607605840438704], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 3.032, "total": 3.396, "mc": 0.364}], "id": "B.194. "}, {"ins_code": " ", "sesa": [{"sc": 55.7568, "total": 61.4071, "mc": 5.6503}], "name": "PRO", "chain": "B", "cv_coarse": [0.19665015923208168], "number": 195, "sap_score": [-0.05339175452616181], "cv_fine": [0.4864802444875157], "name_short": "P", "surface": [true], "secondary_structure": ["H"], "chemical_name": "PROLINE", "fasa": [{"sc": 29.215, "total": 29.353, "mc": 0.139}], "id": "B.195. "}, {"ins_code": " ", "sesa": [{"sc": 69.1689, "total": 86.7761, "mc": 17.6072}], "name": "ASN", "chain": "B", "cv_coarse": [0.21181288577391363], "number": 196, "sap_score": [0.43616186712688204], "cv_fine": [0.44914936225827345], "name_short": "N", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 6.71, "total": 9.235, "mc": 2.526}], "id": "B.196. "}, {"ins_code": " ", "sesa": [{"sc": 59.4227, "total": 62.9681, "mc": 3.5454}], "name": "HIS", "chain": "B", "cv_coarse": [0.29576443753305587], "number": 197, "sap_score": [-0.4197337720882758], "cv_fine": [0.7000707005952871], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 53.156, "total": 53.621, "mc": 0.465}], "id": "B.197. "}, {"ins_code": " ", "sesa": [{"sc": 28.4954, "total": 31.7018, "mc": 3.2064}], "name": "GLU", "chain": "B", "cv_coarse": [0.25532230746370427], "number": 198, "sap_score": [0.43050955551266457], "cv_fine": [0.6519841988752825], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 25.785, "total": 26.29, "mc": 0.505}], "id": "B.198. "}, {"ins_code": " ", "sesa": [{"sc": 68.47200000000001, "total": 83.67680000000001, "mc": 15.2048}], "name": "LEU", "chain": "B", "cv_coarse": [0.21817321487130437], "number": 199, "sap_score": [0.6262463066520206], "cv_fine": [0.4367013836215188], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 75.749, "total": 98.521, "mc": 22.772}], "id": "B.199. "}, {"ins_code": " ", "sesa": [{"sc": 18.081, "total": 28.2296, "mc": 10.1486}], "name": "GLY", "chain": "B", "cv_coarse": [0.26337840357928244], "number": 200, "sap_score": [-1.8259575724773516], "cv_fine": [0.6232134579214987], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 15.813, "total": 18.396, "mc": 2.583}], "id": "B.200. "}, {"ins_code": " ", "sesa": [{"sc": 114.97649999999999, "total": 127.33059999999999, "mc": 12.3541}], "name": "ARG", "chain": "B", "cv_coarse": [0.25165608356669894], "number": 201, "sap_score": [-3.9615120113891855], "cv_fine": [0.37900973982857766], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 168.998, "total": 176.473, "mc": 7.476}], "id": "B.201. "}, {"ins_code": " ", "sesa": [{"sc": 65.94969999999999, "total": 83.78150000000001, "mc": 17.8318}], "name": "ASP", "chain": "B", "cv_coarse": [0.3320869778581189], "number": 202, "sap_score": [-2.52429476376998], "cv_fine": [0.46132711619640765], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 93.13, "total": 109.295, "mc": 16.166}], "id": "B.202. "}, {"ins_code": " ", "sesa": [{"sc": 73.2448, "total": 81.90339999999999, "mc": 8.6586}], "name": "PHE", "chain": "B", "cv_coarse": [0.42171506776079826], "number": 203, "sap_score": [0.6921628048539381], "cv_fine": [0.678823564232633], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 83.847, "total": 84.895, "mc": 1.048}], "id": "B.203. "}, {"ins_code": " ", "sesa": [{"sc": 40.7704, "total": 56.691100000000006, "mc": 15.9207}], "name": "ASN", "chain": "B", "cv_coarse": [0.31502231820251697], "number": 204, "sap_score": [-1.553283543407237], "cv_fine": [0.680690565203968], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 26.456, "total": 44.316, "mc": 17.86}], "id": "B.204. "}, {"ins_code": " ", "sesa": [{"sc": 78.86349999999999, "total": 98.7295, "mc": 19.866}], "name": "GLU", "chain": "B", "cv_coarse": [0.3157992584191367], "number": 205, "sap_score": [-2.963180276028884], "cv_fine": [0.40042614506916885], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 81.967, "total": 108.961, "mc": 26.994}], "id": "B.205. "}, {"ins_code": " ", "sesa": [{"sc": 19.0735, "total": 42.3108, "mc": 23.237299999999998}], "name": "GLY", "chain": "B", "cv_coarse": [0.3834886886575075], "number": 206, "sap_score": [-2.592225720035273], "cv_fine": [0.4292450358895952], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 30.09, "total": 66.527, "mc": 36.437}], "id": "B.206. "}, {"ins_code": " ", "sesa": [{"sc": 51.5764, "total": 70.1471, "mc": 18.570700000000002}], "name": "GLN", "chain": "B", "cv_coarse": [0.41472370954888216], "number": 207, "sap_score": [-1.3719512578175255], "cv_fine": [0.6222412376769804], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 46.527, "total": 63.243, "mc": 16.716}], "id": "B.207. "}, {"ins_code": " ", "sesa": [{"sc": 45.231700000000004, "total": 67.8338, "mc": 22.6021}], "name": "SER", "chain": "B", "cv_coarse": [0.34888815986761695], "number": 208, "sap_score": [-1.094034119161013], "cv_fine": [0.47538284938238656], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 89.927, "total": 112.246, "mc": 22.319}], "id": "B.208. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 15.3885, "mc": 15.3885}], "name": "ALA", "chain": "B", "cv_coarse": [0.383426215503645], "number": 209, "sap_score": [-0.7149110976695414], "cv_fine": [0.682627437006731], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 0.0, "total": 8.362, "mc": 8.362}], "id": "B.209. "}, {"ins_code": " ", "sesa": [{"sc": 34.5968, "total": 34.5968, "mc": 0.0}], "name": "PRO", "chain": "B", "cv_coarse": [0.33142049243542493], "number": 210, "sap_score": [0.33414689893107064], "cv_fine": [0.6365179230077009], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 34.248, "total": 34.248, "mc": 0.0}], "id": "B.210. "}, {"ins_code": " ", "sesa": [{"sc": 32.8224, "total": 42.063199999999995, "mc": 9.2408}], "name": "ALA", "chain": "B", "cv_coarse": [0.3006394973683366], "number": 211, "sap_score": [0.24548639202522346], "cv_fine": [0.660136159910403], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 36.167, "total": 44.653, "mc": 8.486}], "id": "B.211. "}, {"ins_code": " ", "sesa": [{"sc": 33.3251, "total": 38.5704, "mc": 5.2453}], "name": "SER", "chain": "B", "cv_coarse": [0.28455972551572106], "number": 212, "sap_score": [-0.09273025784281785], "cv_fine": [0.6514810419950909], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 38.445, "total": 40.173, "mc": 1.727}], "id": "B.212. "}, {"ins_code": " ", "sesa": [{"sc": 29.2491, "total": 29.2491, "mc": 0.0}], "name": "ARG", "chain": "B", "cv_coarse": [0.5121782695363337], "number": 216, "sap_score": [-0.24422870673331387], "cv_fine": [0.9136254063551275], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 7.571, "total": 7.571, "mc": 0.0}], "id": "B.216. "}, {"ins_code": " ", "sesa": [{"sc": 8.6396, "total": 25.723, "mc": 17.0834}], "name": "VAL", "chain": "B", "cv_coarse": [0.6181058786420294], "number": 217, "sap_score": [-0.29283973919569095], "cv_fine": [0.8853771906791124], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 1.9, "total": 12.047, "mc": 10.147}], "id": "B.217. "}, {"ins_code": " ", "sesa": [{"sc": 39.6061, "total": 56.369200000000006, "mc": 16.7631}], "name": "GLU", "chain": "B", "cv_coarse": [0.6855535761095009], "number": 218, "sap_score": [-1.0381204032207416], "cv_fine": [0.7628201438322617], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 42.114, "total": 65.13, "mc": 23.017}], "id": "B.218. "}, {"ins_code": " ", "sesa": [{"sc": 14.7899, "total": 37.6221, "mc": 22.8322}], "name": "GLY", "chain": "B", "cv_coarse": [0.6808172974300242], "number": 219, "sap_score": [-0.40203515827501485], "cv_fine": [0.8453207040578665], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 9.678, "total": 20.324, "mc": 10.646}], "id": "B.219. "}, {"ins_code": " ", "sesa": [{"sc": 34.8882, "total": 49.9191, "mc": 15.0309}], "name": "ASN", "chain": "B", "cv_coarse": [0.5670165227820464], "number": 220, "sap_score": [-0.6467844652739226], "cv_fine": [0.7375974560291358], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 27.071, "total": 37.146, "mc": 10.076}], "id": "B.220. "}, {"ins_code": " ", "sesa": [{"sc": 66.3671, "total": 87.4291, "mc": 21.061999999999998}], "name": "ASN", "chain": "B", "cv_coarse": [0.45127187330154195], "number": 221, "sap_score": [-0.822715640633052], "cv_fine": [0.5365491042579842], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 127.807, "total": 143.985, "mc": 16.177}], "id": "B.221. "}, {"ins_code": " ", "sesa": [{"sc": 75.29990000000001, "total": 79.304, "mc": 4.004099999999999}], "name": "LEU", "chain": "B", "cv_coarse": [0.43349233050125463], "number": 222, "sap_score": [1.5790279609831206], "cv_fine": [0.5141118392985563], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 115.454, "total": 116.469, "mc": 1.015}], "id": "B.222. "}, {"ins_code": " ", "sesa": [{"sc": 13.9102, "total": 29.2593, "mc": 15.3491}], "name": "SER", "chain": "B", "cv_coarse": [0.4509691286788178], "number": 223, "sap_score": [0.2698824791693845], "cv_fine": [0.7152367644912664], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 7.922, "total": 26.331, "mc": 18.409}], "id": "B.223. "}, {"ins_code": " ", "sesa": [{"sc": 58.190900000000006, "total": 58.190900000000006, "mc": 0.0}], "name": "GLN", "chain": "B", "cv_coarse": [0.37710018557472985], "number": 224, "sap_score": [-0.3657726984956897], "cv_fine": [0.5872202756653241], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 79.686, "total": 79.686, "mc": 0.0}], "id": "B.224. "}, {"ins_code": " ", "sesa": [{"sc": 41.078199999999995, "total": 67.6623, "mc": 26.5841}], "name": "TYR", "chain": "B", "cv_coarse": [0.40776747111375516], "number": 225, "sap_score": [0.671377684571337], "cv_fine": [0.7354319968169084], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 27.886, "total": 57.148, "mc": 29.262}], "id": "B.225. "}, {"ins_code": " ", "sesa": [{"sc": 50.4657, "total": 50.4657, "mc": 0.0}], "name": "VAL", "chain": "B", "cv_coarse": [0.3052765899981574], "number": 226, "sap_score": [0.18544855595336526], "cv_fine": [0.6633366529126388], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 50.997, "total": 50.997, "mc": 0.0}], "id": "B.226. "}, {"ins_code": " ", "sesa": [{"sc": 47.522600000000004, "total": 65.7826, "mc": 18.26}], "name": "ASP", "chain": "B", "cv_coarse": [0.2523107054354077], "number": 227, "sap_score": [-0.9371564687197358], "cv_fine": [0.6049761263521007], "name_short": "D", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 52.984, "total": 68.335, "mc": 15.351}], "id": "B.227. "}, {"ins_code": " ", "sesa": [{"sc": 31.109699999999997, "total": 39.7386, "mc": 8.6289}], "name": "ASP", "chain": "B", "cv_coarse": [0.19954055310658603], "number": 228, "sap_score": [-0.07906075859114678], "cv_fine": [0.6217714808718455], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 33.521, "total": 38.819, "mc": 5.298}], "id": "B.228. "}, {"ins_code": " ", "sesa": [{"sc": 61.112500000000004, "total": 79.19630000000001, "mc": 18.0838}], "name": "PRO", "chain": "B", "cv_coarse": [0.16486321586703426], "number": 229, "sap_score": [1.5069465426117505], "cv_fine": [0.3279658319100821], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 101.009, "total": 131.631, "mc": 30.621}], "id": "B.229. "}, {"ins_code": " ", "sesa": [{"sc": 61.9693, "total": 79.7448, "mc": 17.7755}], "name": "VAL", "chain": "B", "cv_coarse": [0.14212587472384292], "number": 230, "sap_score": [1.7904581969139575], "cv_fine": [0.3578516484324677], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 103.513, "total": 134.835, "mc": 31.322}], "id": "B.230. "}, {"ins_code": " ", "sesa": [{"sc": 38.9337, "total": 55.8202, "mc": 16.8865}], "name": "THR", "chain": "B", "cv_coarse": [0.16752191141736852], "number": 231, "sap_score": [0.6251698041511915], "cv_fine": [0.6438207812884826], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 23.258, "total": 39.765, "mc": 16.507}], "id": "B.231. "}, {"ins_code": " ", "sesa": [{"sc": 17.5942, "total": 33.2581, "mc": 15.6639}], "name": "GLY", "chain": "B", "cv_coarse": [0.20134221151714043], "number": 232, "sap_score": [-0.055691142344292295], "cv_fine": [0.6748887227115338], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 20.815, "total": 27.688, "mc": 6.873}], "id": "B.232. "}, {"ins_code": " ", "sesa": [{"sc": 46.5256, "total": 57.3865, "mc": 10.8609}], "name": "ARG", "chain": "B", "cv_coarse": [0.23522010915428923], "number": 233, "sap_score": [-0.4601788019623375], "cv_fine": [0.8484413794043904], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 22.256, "total": 23.673, "mc": 1.417}], "id": "B.233. "}, {"ins_code": " ", "sesa": [{"sc": 3.8274, "total": 3.8274, "mc": 0.0}], "name": "SER", "chain": "B", "cv_coarse": [0.3723848820795011], "number": 235, "sap_score": [-0.08175489739653968], "cv_fine": [0.8625404685296489], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 0.17, "total": 0.17, "mc": 0.0}], "id": "B.235. "}, {"ins_code": " ", "sesa": [{"sc": 21.5034, "total": 21.5034, "mc": 0.0}], "name": "VAL", "chain": "B", "cv_coarse": [0.42173650021048026], "number": 237, "sap_score": [-0.3860583953676218], "cv_fine": [0.8256229087173471], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 13.798, "total": 13.798, "mc": 0.0}], "id": "B.237. "}, {"ins_code": " ", "sesa": [{"sc": 15.4659, "total": 15.4659, "mc": 0.0}], "name": "VAL", "chain": "B", "cv_coarse": [0.49816193607862197], "number": 238, "sap_score": [0.11813210858324581], "cv_fine": [0.8803797802056257], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 7.231, "total": 7.368, "mc": 0.136}], "id": "B.238. "}, {"ins_code": " ", "sesa": [{"sc": 42.1385, "total": 52.7565, "mc": 10.618}], "name": "PRO", "chain": "B", "cv_coarse": [0.4360601186713692], "number": 239, "sap_score": [0.8462462236452364], "cv_fine": [0.7344657340332493], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 33.111, "total": 35.986, "mc": 2.875}], "id": "B.239. "}, {"ins_code": " ", "sesa": [{"sc": 45.843300000000006, "total": 64.61659999999999, "mc": 18.7733}], "name": "TYR", "chain": "B", "cv_coarse": [0.42193439854811143], "number": 240, "sap_score": [0.403472811481895], "cv_fine": [0.8211471452590103], "name_short": "Y", "surface": [true], "secondary_structure": ["L"], "chemical_name": "TYROSINE", "fasa": [{"sc": 17.326, "total": 38.229, "mc": 20.903}], "id": "B.240. "}, {"ins_code": " ", "sesa": [{"sc": 74.8995, "total": 81.5469, "mc": 6.6474}], "name": "GLU", "chain": "B", "cv_coarse": [0.5079701402932209], "number": 241, "sap_score": [-1.3446498948734482], "cv_fine": [0.7183072005781538], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 104.119, "total": 106.489, "mc": 2.369}], "id": "B.241. "}, {"ins_code": " ", "sesa": [{"sc": 50.7714, "total": 61.7801, "mc": 11.0087}], "name": "PRO", "chain": "B", "cv_coarse": [0.4524887042501919], "number": 242, "sap_score": [0.03623874156766771], "cv_fine": [0.6468688046611913], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 74.137, "total": 77.494, "mc": 3.358}], "id": "B.242. "}, {"ins_code": " ", "sesa": [{"sc": 51.0731, "total": 66.4082, "mc": 15.335099999999999}], "name": "PRO", "chain": "B", "cv_coarse": [0.4919388182244889], "number": 243, "sap_score": [-0.09588041528730677], "cv_fine": [0.725304917095362], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 38.423, "total": 52.123, "mc": 13.7}], "id": "B.243. "}, {"ins_code": " ", "sesa": [{"sc": 71.5207, "total": 86.46360000000001, "mc": 14.9429}], "name": "GLN", "chain": "B", "cv_coarse": [0.5673053570803366], "number": 244, "sap_score": [-0.8295935848111486], "cv_fine": [0.7840876169462144], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 70.767, "total": 81.669, "mc": 10.902}], "id": "B.244. "}, {"ins_code": " ", "sesa": [{"sc": 61.182599999999994, "total": 85.46459999999999, "mc": 24.281999999999996}], "name": "VAL", "chain": "B", "cv_coarse": [0.47232678752884955], "number": 245, "sap_score": [0.7475880531733077], "cv_fine": [0.6929658944950331], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 61.401, "total": 71.193, "mc": 9.792}], "id": "B.245. "}, {"ins_code": " ", "sesa": [{"sc": 20.1665, "total": 46.7777, "mc": 26.611200000000004}], "name": "GLY", "chain": "B", "cv_coarse": [0.42425854475869335], "number": 246, "sap_score": [0.34880763393358527], "cv_fine": [0.5019302499008569], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 36.311, "total": 76.472, "mc": 40.161}], "id": "B.246. "}, {"ins_code": " ", "sesa": [{"sc": 61.848400000000005, "total": 78.7047, "mc": 16.8563}], "name": "THR", "chain": "B", "cv_coarse": [0.4613018329233933], "number": 247, "sap_score": [-1.4922125226048923], "cv_fine": [0.5605521982063083], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 79.839, "total": 85.43, "mc": 5.59}], "id": "B.247. "}, {"ins_code": " ", "sesa": [{"sc": 73.053, "total": 89.2439, "mc": 16.1909}], "name": "GLU", "chain": "B", "cv_coarse": [0.4550103194599162], "number": 248, "sap_score": [-2.1590222882131846], "cv_fine": [0.5410650638906298], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 96.109, "total": 101.747, "mc": 5.638}], "id": "B.248. "}, {"ins_code": " ", "sesa": [{"sc": 86.9057, "total": 89.21249999999999, "mc": 2.3068}], "name": "PHE", "chain": "B", "cv_coarse": [0.5886094888881429], "number": 249, "sap_score": [0.7453410812062304], "cv_fine": [0.7203324457963328], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 89.189, "total": 89.552, "mc": 0.363}], "id": "B.249. "}, {"ins_code": " ", "sesa": [{"sc": 46.1475, "total": 46.1475, "mc": 0.0}], "name": "THR", "chain": "B", "cv_coarse": [0.6036742738413935], "number": 250, "sap_score": [0.02575516978963637], "cv_fine": [0.8807482281286598], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 19.499, "total": 19.499, "mc": 0.0}], "id": "B.250. "}, {"ins_code": " ", "sesa": [{"sc": 42.032000000000004, "total": 63.9032, "mc": 21.8712}], "name": "THR", "chain": "B", "cv_coarse": [0.7352155720636476], "number": 251, "sap_score": [0.12759768102363614], "cv_fine": [0.8591864525595035], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 42.144, "total": 61.29, "mc": 19.146}], "id": "B.251. "}, {"ins_code": " ", "sesa": [{"sc": 23.2777, "total": 23.2777, "mc": 0.0}], "name": "ILE", "chain": "B", "cv_coarse": [0.7024318399730816], "number": 252, "sap_score": [0.4194879489514922], "cv_fine": [0.9308698824539302], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 11.486, "total": 11.486, "mc": 0.0}], "id": "B.252. "}, {"ins_code": " ", "sesa": [{"sc": 40.0538, "total": 45.6051, "mc": 5.5513}], "name": "LEU", "chain": "B", "cv_coarse": [0.805158551185844], "number": 253, "sap_score": [0.5525106654173977], "cv_fine": [0.8629422264747235], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 12.485, "total": 14.097, "mc": 1.612}], "id": "B.253. "}, {"ins_code": " ", "sesa": [{"sc": 15.5276, "total": 15.5276, "mc": 0.0}], "name": "ASN", "chain": "B", "cv_coarse": [0.636838831171211], "number": 255, "sap_score": [-0.8027161835985328], "cv_fine": [0.8998716561329718], "name_short": "N", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 8.602, "total": 8.602, "mc": 0.0}], "id": "B.255. "}, {"ins_code": " ", "sesa": [{"sc": 14.763100000000001, "total": 18.5268, "mc": 3.7637}], "name": "MET", "chain": "B", "cv_coarse": [0.47005165764923595], "number": 257, "sap_score": [-0.021573696439891748], "cv_fine": [0.9014879410714471], "name_short": "M", "surface": [true], "secondary_structure": ["L"], "chemical_name": "METHIONINE", "fasa": [{"sc": 3.599, "total": 3.602, "mc": 0.003}], "id": "B.257. "}, {"ins_code": " ", "sesa": [{"sc": 30.747, "total": 30.747, "mc": 0.0}], "name": "ASN", "chain": "B", "cv_coarse": [0.34211441707759827], "number": 259, "sap_score": [0.0798030332861133], "cv_fine": [0.761956862432764], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 26.121, "total": 26.141, "mc": 0.02}], "id": "B.259. "}, {"ins_code": " ", "sesa": [{"sc": 16.0978, "total": 16.0978, "mc": 0.0}], "name": "SER", "chain": "B", "cv_coarse": [0.312783437622644], "number": 260, "sap_score": [-0.4071276000736928], "cv_fine": [0.8801311268690627], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 2.831, "total": 2.831, "mc": 0.0}], "id": "B.260. "}, {"ins_code": " ", "sesa": [{"sc": 36.0171, "total": 53.1046, "mc": 17.0875}], "name": "SER", "chain": "B", "cv_coarse": [0.2549328739403778], "number": 261, "sap_score": [-0.716187906395539], "cv_fine": [0.6208964131615249], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 38.581, "total": 49.615, "mc": 11.034}], "id": "B.261. "}, {"ins_code": " ", "sesa": [{"sc": 21.5705, "total": 22.6909, "mc": 1.1204}], "name": "CYS", "chain": "B", "cv_coarse": [0.2529352318905597], "number": 262, "sap_score": [0.15181549230578784], "cv_fine": [0.7013313800595623], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 16.405, "total": 16.409, "mc": 0.004}], "id": "B.262. "}, {"ins_code": " ", "sesa": [{"sc": 68.4069, "total": 82.9568, "mc": 14.549900000000001}], "name": "VAL", "chain": "B", "cv_coarse": [0.19010619830473116], "number": 263, "sap_score": [1.032514644144132], "cv_fine": [0.46353671288006737], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 93.404, "total": 94.521, "mc": 1.117}], "id": "B.263. "}, {"ins_code": " ", "sesa": [{"sc": 13.875, "total": 34.445499999999996, "mc": 20.570500000000003}], "name": "GLY", "chain": "B", "cv_coarse": [0.19157219900620615], "number": 264, "sap_score": [0.38705374355106964], "cv_fine": [0.5537679129726218], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 15.393, "total": 45.257, "mc": 29.864}], "id": "B.264. "}, {"ins_code": " ", "sesa": [{"sc": 7.9788, "total": 14.8446, "mc": 6.8658}], "name": "GLY", "chain": "B", "cv_coarse": [0.22718163612671757], "number": 265, "sap_score": [-0.3894757822215323], "cv_fine": [0.7629207521155272], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 3.105, "total": 6.468, "mc": 3.363}], "id": "B.265. "}, {"ins_code": " ", "sesa": [{"sc": 35.6802, "total": 47.30500000000001, "mc": 11.6248}], "name": "ASN", "chain": "B", "cv_coarse": [0.1913994389504215], "number": 267, "sap_score": [-1.3697019880888663], "cv_fine": [0.5861446097868812], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 39.683, "total": 47.557, "mc": 7.875}], "id": "B.267. "}, {"ins_code": " ", "sesa": [{"sc": 98.0226, "total": 119.9647, "mc": 21.9421}], "name": "ARG", "chain": "B", "cv_coarse": [0.18560222401555135], "number": 268, "sap_score": [-3.081427809965069], "cv_fine": [0.39890564067792733], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 164.47, "total": 184.354, "mc": 19.883}], "id": "B.268. "}, {"ins_code": " ", "sesa": [{"sc": 67.0571, "total": 67.0571, "mc": 0.0}], "name": "ARG", "chain": "B", "cv_coarse": [0.2015580337483651], "number": 269, "sap_score": [-1.3026500209422633], "cv_fine": [0.6938174064620581], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 52.673, "total": 52.673, "mc": 0.0}], "id": "B.269. "}, {"ins_code": " ", "sesa": [{"sc": 53.769999999999996, "total": 65.0053, "mc": 11.2353}], "name": "PRO", "chain": "B", "cv_coarse": [0.25091212406439983], "number": 270, "sap_score": [-0.21293004563297624], "cv_fine": [0.703255577956447], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 53.491, "total": 53.912, "mc": 0.421}], "id": "B.270. "}, {"ins_code": " ", "sesa": [{"sc": 34.4572, "total": 34.4572, "mc": 0.0}], "name": "LEU", "chain": "B", "cv_coarse": [0.3198333097572667], "number": 272, "sap_score": [-0.3951145362591967], "cv_fine": [0.8600926077302913], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 15.402, "total": 15.402, "mc": 0.0}], "id": "B.272. "}, {"ins_code": " ", "sesa": [{"sc": 27.369300000000003, "total": 27.369300000000003, "mc": 0.0}], "name": "ILE", "chain": "B", "cv_coarse": [0.3736585206075011], "number": 274, "sap_score": [0.116044225980876], "cv_fine": [0.9317731690242459], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 10.742, "total": 10.766, "mc": 0.024}], "id": "B.274. "}, {"ins_code": " ", "sesa": [{"sc": 20.0728, "total": 20.0728, "mc": 0.0}], "name": "THR", "chain": "B", "cv_coarse": [0.36449354111640214], "number": 276, "sap_score": [-0.15889523512446813], "cv_fine": [0.9111935673625849], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 9.362, "total": 9.362, "mc": 0.0}], "id": "B.276. "}, {"ins_code": " ", "sesa": [{"sc": 35.044, "total": 38.2464, "mc": 3.2024}], "name": "GLU", "chain": "B", "cv_coarse": [0.2973158244722461], "number": 278, "sap_score": [-0.39589637148093215], "cv_fine": [0.792697861959878], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 30.385, "total": 30.418, "mc": 0.034}], "id": "B.278. "}, {"ins_code": " ", "sesa": [{"sc": 50.4684, "total": 59.480999999999995, "mc": 9.012599999999999}], "name": "MET", "chain": "B", "cv_coarse": [0.2378101705502096], "number": 279, "sap_score": [-0.6918296025836906], "cv_fine": [0.6501520836194873], "name_short": "M", "surface": [true], "secondary_structure": ["L"], "chemical_name": "METHIONINE", "fasa": [{"sc": 57.598, "total": 62.035, "mc": 4.436}], "id": "B.279. "}, {"ins_code": " ", "sesa": [{"sc": 97.4071, "total": 114.0299, "mc": 16.6228}], "name": "ARG", "chain": "B", "cv_coarse": [0.22491531166264386], "number": 280, "sap_score": [-2.6913442679138737], "cv_fine": [0.40336554378915374], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 146.287, "total": 176.587, "mc": 30.3}], "id": "B.280. "}, {"ins_code": " ", "sesa": [{"sc": 48.5923, "total": 71.05099999999999, "mc": 22.4587}], "name": "ASP", "chain": "B", "cv_coarse": [0.1866117035397068], "number": 281, "sap_score": [-3.623031213775621], "cv_fine": [0.37554136435653807], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 76.565, "total": 106.484, "mc": 29.92}], "id": "B.281. "}, {"ins_code": " ", "sesa": [{"sc": 14.9693, "total": 28.269499999999997, "mc": 13.3002}], "name": "GLY", "chain": "B", "cv_coarse": [0.22339546151982823], "number": 282, "sap_score": [-2.770927991877305], "cv_fine": [0.5157701450942298], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 19.721, "total": 31.724, "mc": 12.003}], "id": "B.282. "}, {"ins_code": " ", "sesa": [{"sc": 75.1943, "total": 77.5161, "mc": 2.3218}], "name": "GLN", "chain": "B", "cv_coarse": [0.1861883575319759], "number": 283, "sap_score": [-1.755586305370978], "cv_fine": [0.4196546675258384], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 123.84, "total": 123.87, "mc": 0.031}], "id": "B.283. "}, {"ins_code": " ", "sesa": [{"sc": 41.034800000000004, "total": 63.3107, "mc": 22.2759}], "name": "VAL", "chain": "B", "cv_coarse": [0.22958341017268952], "number": 284, "sap_score": [0.9501080546514836], "cv_fine": [0.6293507298421892], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 51.139, "total": 66.372, "mc": 15.233}], "id": "B.284. "}, {"ins_code": " ", "sesa": [{"sc": 35.311400000000006, "total": 35.311400000000006, "mc": 0.0}], "name": "LEU", "chain": "B", "cv_coarse": [0.2511080868137918], "number": 285, "sap_score": [1.157563718860435], "cv_fine": [0.7367898197627301], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 26.262, "total": 26.262, "mc": 0.0}], "id": "B.285. "}, {"ins_code": " ", "sesa": [{"sc": 30.6625, "total": 30.6625, "mc": 0.0}], "name": "ARG", "chain": "B", "cv_coarse": [0.28096251264637656], "number": 287, "sap_score": [-0.5154595355030972], "cv_fine": [0.7893389419818864], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 22.751, "total": 22.751, "mc": 0.0}], "id": "B.287. "}, {"ins_code": " ", "sesa": [{"sc": 39.7664, "total": 39.7664, "mc": 0.0}], "name": "ARG", "chain": "B", "cv_coarse": [0.33925312921886647], "number": 288, "sap_score": [-0.7585189314787624], "cv_fine": [0.7589593363440499], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 32.245, "total": 32.814, "mc": 0.569}], "id": "B.288. "}, {"ins_code": " ", "sesa": [{"sc": 10.0235, "total": 20.2985, "mc": 10.275}], "name": "SER", "chain": "B", "cv_coarse": [0.3440162377316969], "number": 289, "sap_score": [-0.4653913748041852], "cv_fine": [0.8455395322458745], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 3.7, "total": 8.683, "mc": 4.982}], "id": "B.289. "}, {"ins_code": " ", "sesa": [{"sc": 18.92, "total": 18.92, "mc": 0.0}], "name": "PHE", "chain": "B", "cv_coarse": [0.43019972227140707], "number": 290, "sap_score": [0.19055343988006207], "cv_fine": [0.9269773463250431], "name_short": "F", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 3.9, "total": 3.9, "mc": 0.0}], "id": "B.290. "}, {"ins_code": " ", "sesa": [{"sc": 28.721600000000002, "total": 28.721600000000002, "mc": 0.0}], "name": "GLU", "chain": "B", "cv_coarse": [0.3250210138671555], "number": 291, "sap_score": [-0.5677176393988236], "cv_fine": [0.7855111313026606], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 21.942, "total": 21.942, "mc": 0.0}], "id": "B.291. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 3.4881, "mc": 3.4881}], "name": "GLY", "chain": "B", "cv_coarse": [0.3973862574038821], "number": 292, "sap_score": [-0.12367012597165414], "cv_fine": [0.9579831599022095], "name_short": "G", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLYCINE", "fasa": [{"sc": 0.443, "total": 0.735, "mc": 0.291}], "id": "B.292. "}, {"ins_code": " ", "sesa": [{"sc": 80.2417, "total": 80.2417, "mc": 0.0}], "name": "ARG", "chain": "B", "cv_coarse": [0.3408002061278667], "number": 293, "sap_score": [-0.9907606699918825], "cv_fine": [0.7955851059191503], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 83.27, "total": 83.27, "mc": 0.0}], "id": "B.293. "}, {"ins_code": " ", "sesa": [{"sc": 16.3948, "total": 16.3948, "mc": 0.0}], "name": "CYS", "chain": "B", "cv_coarse": [0.3684057954411799], "number": 295, "sap_score": [-0.2186851382572046], "cv_fine": [0.7428553300093941], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 9.529, "total": 9.529, "mc": 0.0}], "id": "B.295. "}, {"ins_code": " ", "sesa": [{"sc": 36.8617, "total": 52.3576, "mc": 15.4959}], "name": "ALA", "chain": "B", "cv_coarse": [0.34174326816937983], "number": 296, "sap_score": [0.37083133477529356], "cv_fine": [0.4820882103865477], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 58.236, "total": 70.044, "mc": 11.809}], "id": "B.296. "}, {"ins_code": " ", "sesa": [{"sc": 43.9378, "total": 49.3113, "mc": 5.3735}], "name": "CYS", "chain": "B", "cv_coarse": [0.3340856480393098], "number": 297, "sap_score": [-0.15101239438784034], "cv_fine": [0.5743100487940643], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 53.889, "total": 54.251, "mc": 0.362}], "id": "B.297. "}, {"ins_code": " ", "sesa": [{"sc": 8.7748, "total": 8.7748, "mc": 0.0}], "name": "PRO", "chain": "B", "cv_coarse": [0.4096262744851538], "number": 298, "sap_score": [-0.030516305296256208], "cv_fine": [0.8407899855967325], "name_short": "P", "surface": [true], "secondary_structure": ["H"], "chemical_name": "PROLINE", "fasa": [{"sc": 1.975, "total": 1.975, "mc": 0.0}], "id": "B.298. "}, {"ins_code": " ", "sesa": [{"sc": 12.7892, "total": 25.0658, "mc": 12.276599999999998}], "name": "GLY", "chain": "B", "cv_coarse": [0.3548640514449495], "number": 299, "sap_score": [-0.5361778349677379], "cv_fine": [0.7609913773792272], "name_short": "G", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLYCINE", "fasa": [{"sc": 4.564, "total": 9.998, "mc": 5.435}], "id": "B.299. "}, {"ins_code": " ", "sesa": [{"sc": 93.13889999999999, "total": 99.5146, "mc": 6.3757}], "name": "ARG", "chain": "B", "cv_coarse": [0.2639834369358178], "number": 300, "sap_score": [-1.7217781793838096], "cv_fine": [0.48010101823135365], "name_short": "R", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ARGININE", "fasa": [{"sc": 133.83, "total": 134.643, "mc": 0.813}], "id": "B.300. "}, {"ins_code": " ", "sesa": [{"sc": 32.5685, "total": 32.5685, "mc": 0.0}], "name": "ASP", "chain": "B", "cv_coarse": [0.2993967549885741], "number": 301, "sap_score": [-0.8951329953484686], "cv_fine": [0.7080709359379391], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 18.066, "total": 18.066, "mc": 0.0}], "id": "B.301. "}, {"ins_code": " ", "sesa": [{"sc": 56.2238, "total": 56.2238, "mc": 0.0}], "name": "ARG", "chain": "B", "cv_coarse": [0.3427575942393401], "number": 302, "sap_score": [-1.372320270727623], "cv_fine": [0.7421024469886786], "name_short": "R", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ARGININE", "fasa": [{"sc": 66.672, "total": 66.672, "mc": 0.0}], "id": "B.302. "}, {"ins_code": " ", "sesa": [{"sc": 78.1715, "total": 81.1001, "mc": 2.9286}], "name": "LYS", "chain": "B", "cv_coarse": [0.25240364191922193], "number": 303, "sap_score": [-1.4419805763273517], "cv_fine": [0.5738752244853451], "name_short": "K", "surface": [true], "secondary_structure": ["H"], "chemical_name": "LYSINE", "fasa": [{"sc": 90.054, "total": 90.67, "mc": 0.616}], "id": "B.303. "}, {"ins_code": " ", "sesa": [{"sc": 34.4417, "total": 43.4345, "mc": 8.992799999999999}], "name": "ALA", "chain": "B", "cv_coarse": [0.221359336713643], "number": 304, "sap_score": [-2.101860865279546], "cv_fine": [0.6324860763977254], "name_short": "A", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ALANINE", "fasa": [{"sc": 41.257, "total": 46.319, "mc": 5.062}], "id": "B.304. "}, {"ins_code": " ", "sesa": [{"sc": 50.5233, "total": 57.437200000000004, "mc": 6.9139}], "name": "ASP", "chain": "B", "cv_coarse": [0.23628500054380802], "number": 305, "sap_score": [-1.272765780382482], "cv_fine": [0.6833626783373639], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 58.582, "total": 60.596, "mc": 2.014}], "id": "B.305. "}, {"ins_code": " ", "sesa": [{"sc": 38.3246, "total": 42.4297, "mc": 4.1051}], "name": "GLU", "chain": "B", "cv_coarse": [0.24954248156901299], "number": 306, "sap_score": [-1.8476168398678503], "cv_fine": [0.7486777426917101], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 34.714, "total": 35.885, "mc": 1.171}], "id": "B.306. "}, {"ins_code": " ", "sesa": [{"sc": 57.855999999999995, "total": 70.10849999999999, "mc": 12.252500000000001}], "name": "ASP", "chain": "B", "cv_coarse": [0.1835084163589542], "number": 307, "sap_score": [-3.422312145722892], "cv_fine": [0.47965513310386526], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 92.983, "total": 106.851, "mc": 13.868}], "id": "B.307. "}, {"ins_code": " ", "sesa": [{"sc": 84.87219999999999, "total": 98.01490000000001, "mc": 13.1427}], "name": "HIS", "chain": "B", "cv_coarse": [0.1526034700904028], "number": 308, "sap_score": [-2.871356997380084], "cv_fine": [0.35138480647507925], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 151.816, "total": 163.751, "mc": 11.935}], "id": "B.308. "}, {"ins_code": " ", "sesa": [{"sc": 93.56559999999999, "total": 106.39819999999999, "mc": 12.8326}], "name": "TYR", "chain": "B", "cv_coarse": [0.16866406374845452], "number": 309, "sap_score": [0.5019785579314325], "cv_fine": [0.4410920412718207], "name_short": "Y", "surface": [true], "secondary_structure": ["H"], "chemical_name": "TYROSINE", "fasa": [{"sc": 133.412, "total": 153.051, "mc": 19.639}], "id": "B.309. "}, {"ins_code": " ", "sesa": [{"sc": 112.126, "total": 138.4751, "mc": 26.3491}], "name": "ARG", "chain": "B", "cv_coarse": [0.1668933398926267], "number": 310, "sap_score": [-4.200540290300924], "cv_fine": [0.3249655964360782], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 181.583, "total": 231.787, "mc": 50.204}], "id": "B.310. "}, {"ins_code": " ", "sesa": [{"sc": 41.7553, "total": 68.18260000000001, "mc": 26.4273}], "name": "GLU", "chain": "G", "cv_coarse": [0.1566986505517943], "number": 113, "sap_score": [-5.1963253792575514], "cv_fine": [0.444732593046815], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 83.548, "total": 125.978, "mc": 42.43}], "id": "G.113. "}, {"ins_code": " ", "sesa": [{"sc": 33.8003, "total": 52.4024, "mc": 18.6021}], "name": "PHE", "chain": "G", "cv_coarse": [0.1459021793618343], "number": 114, "sap_score": [-1.6224225300885542], "cv_fine": [0.523432111446536], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 57.638, "total": 70.28, "mc": 12.642}], "id": "G.114. "}, {"ins_code": " ", "sesa": [{"sc": 77.1909, "total": 100.2694, "mc": 23.0785}], "name": "ILE", "chain": "G", "cv_coarse": [0.1476289007341384], "number": 115, "sap_score": [2.814860291455404], "cv_fine": [0.5331475290407355], "name_short": "I", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 116.825, "total": 136.788, "mc": 19.963}], "id": "G.115. "}, {"ins_code": " ", "sesa": [{"sc": 44.970200000000006, "total": 61.974399999999996, "mc": 17.0042}], "name": "PRO", "chain": "G", "cv_coarse": [0.20473651190311495], "number": 116, "sap_score": [0.8425916390363865], "cv_fine": [0.7420840574846214], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 21.359, "total": 32.57, "mc": 11.211}], "id": "G.116. "}, {"ins_code": " ", "sesa": [{"sc": 37.681, "total": 56.96, "mc": 19.279}], "name": "SER", "chain": "G", "cv_coarse": [0.1960584257431528], "number": 117, "sap_score": [-0.6301695322154238], "cv_fine": [0.6095912795708814], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 59.591, "total": 64.586, "mc": 4.995}], "id": "G.117. "}, {"ins_code": " ", "sesa": [{"sc": 55.2769, "total": 76.64410000000001, "mc": 21.367199999999997}], "name": "ASN", "chain": "G", "cv_coarse": [0.21208726938354616], "number": 118, "sap_score": [-0.9876599331303648], "cv_fine": [0.5775524429174916], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 73.648, "total": 84.955, "mc": 11.307}], "id": "G.118. "}, {"ins_code": " ", "sesa": [{"sc": 53.6249, "total": 53.6249, "mc": 0.0}], "name": "THR", "chain": "G", "cv_coarse": [0.21022839571453522], "number": 119, "sap_score": [-1.1609800081590869], "cv_fine": [0.5026516298784153], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 79.94, "total": 79.94, "mc": 0.0}], "id": "G.119. "}, {"ins_code": " ", "sesa": [{"sc": 39.4377, "total": 56.856899999999996, "mc": 17.4192}], "name": "ASP", "chain": "G", "cv_coarse": [0.25345923919208296], "number": 120, "sap_score": [-1.274963282205155], "cv_fine": [0.5496421093277406], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 45.128, "total": 60.713, "mc": 15.585}], "id": "G.120. "}, {"ins_code": " ", "sesa": [{"sc": 83.4316, "total": 83.4316, "mc": 0.0}], "name": "TYR", "chain": "G", "cv_coarse": [0.21591522768563595], "number": 121, "sap_score": [1.442825720814801], "cv_fine": [0.5307259371142897], "name_short": "Y", "surface": [true], "secondary_structure": ["L"], "chemical_name": "TYROSINE", "fasa": [{"sc": 109.673, "total": 109.673, "mc": 0.0}], "id": "G.121. "}, {"ins_code": " ", "sesa": [{"sc": 48.9212, "total": 60.5575, "mc": 11.6363}], "name": "PRO", "chain": "G", "cv_coarse": [0.2337572746969981], "number": 122, "sap_score": [0.6002012606189832], "cv_fine": [0.5282447913954362], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 60.477, "total": 71.19, "mc": 10.713}], "id": "G.122. "}, {"ins_code": " ", "sesa": [{"sc": 2.9923, "total": 15.3488, "mc": 12.3565}], "name": "GLY", "chain": "G", "cv_coarse": [0.23690938294744815], "number": 123, "sap_score": [0.933289394382982], "cv_fine": [0.5988697577561488], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 0.301, "total": 12.412, "mc": 12.112}], "id": "G.123. "}, {"ins_code": " ", "sesa": [{"sc": 56.332, "total": 78.86509999999998, "mc": 22.5331}], "name": "PRO", "chain": "G", "cv_coarse": [0.20787905385523522], "number": 124, "sap_score": [0.9284494870924015], "cv_fine": [0.4513259001706103], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 83.365, "total": 112.625, "mc": 29.26}], "id": "G.124. "}, {"ins_code": " ", "sesa": [{"sc": 28.7064, "total": 28.7064, "mc": 0.0}], "name": "HIS", "chain": "G", "cv_coarse": [0.257733871021549], "number": 125, "sap_score": [0.52027915283603], "cv_fine": [0.6465614517937779], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 24.337, "total": 24.337, "mc": 0.0}], "id": "G.125. "}, {"ins_code": " ", "sesa": [{"sc": 73.8894, "total": 80.1703, "mc": 6.280899999999999}], "name": "HIS", "chain": "G", "cv_coarse": [0.27016550211105966], "number": 126, "sap_score": [-1.193605800429585], "cv_fine": [0.5254565092156631], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 91.741, "total": 91.953, "mc": 0.212}], "id": "G.126. "}, {"ins_code": " ", "sesa": [{"sc": 33.2754, "total": 33.2754, "mc": 0.0}], "name": "GLU", "chain": "G", "cv_coarse": [0.36301860071920844], "number": 128, "sap_score": [-1.3929886287015116], "cv_fine": [0.6584188841323676], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 39.452, "total": 39.452, "mc": 0.0}], "id": "G.128. "}, {"ins_code": " ", "sesa": [{"sc": 6.362, "total": 22.945, "mc": 16.583}], "name": "VAL", "chain": "G", "cv_coarse": [0.4468471217135977], "number": 129, "sap_score": [0.1962512013358764], "cv_fine": [0.8715097531378874], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 1.53, "total": 12.915, "mc": 11.385}], "id": "G.129. "}, {"ins_code": " ", "sesa": [{"sc": 43.1829, "total": 43.1829, "mc": 0.0}], "name": "THR", "chain": "G", "cv_coarse": [0.47918862113669414], "number": 130, "sap_score": [0.5382356419396443], "cv_fine": [0.7419748546008275], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 46.748, "total": 46.748, "mc": 0.0}], "id": "G.130. "}, {"ins_code": " ", "sesa": [{"sc": 29.7591, "total": 48.904399999999995, "mc": 19.1453}], "name": "PHE", "chain": "G", "cv_coarse": [0.5326787071283848], "number": 131, "sap_score": [0.6739527415645616], "cv_fine": [0.8376598769025345], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 5.564, "total": 29.965, "mc": 24.402}], "id": "G.131. "}, {"ins_code": " ", "sesa": [{"sc": 76.58770000000001, "total": 88.79429999999999, "mc": 12.2066}], "name": "GLN", "chain": "G", "cv_coarse": [0.6018089978479508], "number": 132, "sap_score": [-0.9696086900979214], "cv_fine": [0.6244868879704886], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 87.292, "total": 92.14, "mc": 4.848}], "id": "G.132. "}, {"ins_code": " ", "sesa": [{"sc": 79.7383, "total": 94.6677, "mc": 14.9294}], "name": "GLN", "chain": "G", "cv_coarse": [0.49763688363656716], "number": 133, "sap_score": [-2.288052336754118], "cv_fine": [0.42656726093113795], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 143.435, "total": 155.392, "mc": 11.957}], "id": "G.133. "}, {"ins_code": " ", "sesa": [{"sc": 26.235000000000003, "total": 52.064099999999996, "mc": 25.829099999999997}], "name": "SER", "chain": "G", "cv_coarse": [0.510847356829356], "number": 134, "sap_score": [-1.9120209097857332], "cv_fine": [0.6526291447405538], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 9.558, "total": 28.514, "mc": 18.956}], "id": "G.134. "}, {"ins_code": " ", "sesa": [{"sc": 35.2101, "total": 46.8974, "mc": 11.6873}], "name": "SER", "chain": "G", "cv_coarse": [0.47049618960881956], "number": 135, "sap_score": [-0.8246308369082672], "cv_fine": [0.5580611599103401], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 54.977, "total": 64.899, "mc": 9.922}], "id": "G.135. "}, {"ins_code": " ", "sesa": [{"sc": 64.91380000000001, "total": 86.8356, "mc": 21.9218}], "name": "THR", "chain": "G", "cv_coarse": [0.3652845912274647], "number": 136, "sap_score": [-0.42800318364449746], "cv_fine": [0.45393608631913274], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 106.093, "total": 124.665, "mc": 18.572}], "id": "G.136. "}, {"ins_code": " ", "sesa": [{"sc": 36.3673, "total": 45.2088, "mc": 8.8415}], "name": "ALA", "chain": "G", "cv_coarse": [0.38471593368954504], "number": 137, "sap_score": [-0.5647851518146548], "cv_fine": [0.46681080022362176], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 53.806, "total": 54.578, "mc": 0.771}], "id": "G.137. "}, {"ins_code": " ", "sesa": [{"sc": 78.1284, "total": 98.2995, "mc": 20.1711}], "name": "LYS", "chain": "G", "cv_coarse": [0.32410602673460814], "number": 138, "sap_score": [-1.2105381377793736], "cv_fine": [0.46567929106379186], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 104.052, "total": 120.345, "mc": 16.293}], "id": "G.138. "}, {"ins_code": " ", "sesa": [{"sc": 42.5868, "total": 65.63900000000001, "mc": 23.0522}], "name": "SER", "chain": "G", "cv_coarse": [0.41639575587252287], "number": 139, "sap_score": [-0.7421949659831046], "cv_fine": [0.4139665646041333], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 83.629, "total": 103.585, "mc": 19.955}], "id": "G.139. "}, {"ins_code": " ", "sesa": [{"sc": 12.9591, "total": 23.2303, "mc": 10.2712}], "name": "ALA", "chain": "G", "cv_coarse": [0.4814998711591569], "number": 140, "sap_score": [-0.639577108457249], "cv_fine": [0.6456450933938622], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 8.343, "total": 10.224, "mc": 1.881}], "id": "G.140. "}, {"ins_code": " ", "sesa": [{"sc": 46.196600000000004, "total": 53.8758, "mc": 7.6792}], "name": "THR", "chain": "G", "cv_coarse": [0.5696727909052438], "number": 141, "sap_score": [-0.11901781609322393], "cv_fine": [0.7673130382925665], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 46.768, "total": 51.653, "mc": 4.885}], "id": "G.141. "}, {"ins_code": " ", "sesa": [{"sc": 36.2696, "total": 44.861700000000006, "mc": 8.5921}], "name": "TRP", "chain": "G", "cv_coarse": [0.6193805915403615], "number": 142, "sap_score": [0.23970116085100943], "cv_fine": [0.8723472119708406], "name_short": "W", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TRYPTOPHAN", "fasa": [{"sc": 14.832, "total": 16.66, "mc": 1.829}], "id": "G.142. "}, {"ins_code": " ", "sesa": [{"sc": 14.9164, "total": 14.9164, "mc": 0.0}], "name": "THR", "chain": "G", "cv_coarse": [0.4707414293175267], "number": 143, "sap_score": [-0.3882402788460662], "cv_fine": [0.8880208692340223], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 2.867, "total": 2.867, "mc": 0.0}], "id": "G.143. "}, {"ins_code": " ", "sesa": [{"sc": 41.1235, "total": 54.0611, "mc": 12.9376}], "name": "TYR", "chain": "G", "cv_coarse": [0.4327625691954156], "number": 144, "sap_score": [0.43905750494118734], "cv_fine": [0.8113313447120989], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 25.749, "total": 32.371, "mc": 6.622}], "id": "G.144. "}, {"ins_code": " ", "sesa": [{"sc": 3.5147, "total": 3.5147, "mc": 0.0}], "name": "SER", "chain": "G", "cv_coarse": [0.34992086416909923], "number": 145, "sap_score": [0.7067929013512477], "cv_fine": [0.7161142159502322], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 0.736, "total": 0.736, "mc": 0.0}], "id": "G.145. "}, {"ins_code": " ", "sesa": [{"sc": 51.890800000000006, "total": 68.1828, "mc": 16.291999999999998}], "name": "PRO", "chain": "G", "cv_coarse": [0.33196788307535346], "number": 146, "sap_score": [2.1811766263206422], "cv_fine": [0.49095136752164376], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 80.889, "total": 100.688, "mc": 19.799}], "id": "G.146. "}, {"ins_code": " ", "sesa": [{"sc": 64.6763, "total": 83.50140000000002, "mc": 18.8251}], "name": "LEU", "chain": "G", "cv_coarse": [0.2501042298999172], "number": 147, "sap_score": [3.544389026345459], "cv_fine": [0.4848952165832767], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 79.361, "total": 105.354, "mc": 25.992}], "id": "G.147. "}, {"ins_code": " ", "sesa": [{"sc": 45.7427, "total": 54.9567, "mc": 9.214}], "name": "LEU", "chain": "G", "cv_coarse": [0.26516659680426985], "number": 148, "sap_score": [1.9863389165702354], "cv_fine": [0.5867994745273948], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 52.468, "total": 58.219, "mc": 5.752}], "id": "G.148. "}, {"ins_code": " ", "sesa": [{"sc": 65.5183, "total": 69.9119, "mc": 4.3936}], "name": "LYS", "chain": "G", "cv_coarse": [0.3244577397019375], "number": 149, "sap_score": [-0.4536616023302051], "cv_fine": [0.6603284845940078], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 72.327, "total": 73.041, "mc": 0.714}], "id": "G.149. "}, {"ins_code": " ", "sesa": [{"sc": 30.9583, "total": 30.9583, "mc": 0.0}], "name": "LYS", "chain": "G", "cv_coarse": [0.34588858530454264], "number": 150, "sap_score": [-0.39046234958587156], "cv_fine": [0.8028274626890256], "name_short": "K", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LYSINE", "fasa": [{"sc": 26.131, "total": 26.131, "mc": 0.0}], "id": "G.150. "}, {"ins_code": " ", "sesa": [{"sc": 47.8929, "total": 47.8929, "mc": 0.0}], "name": "GLN", "chain": "G", "cv_coarse": [0.48879180569651254], "number": 154, "sap_score": [-0.2736809106669849], "cv_fine": [0.7028048877328605], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 53.525, "total": 53.525, "mc": 0.0}], "id": "G.154. "}, {"ins_code": " ", "sesa": [{"sc": 45.9084, "total": 59.3718, "mc": 13.4634}], "name": "ILE", "chain": "G", "cv_coarse": [0.4618979435787397], "number": 155, "sap_score": [0.6662877483556663], "cv_fine": [0.7118573914572351], "name_short": "I", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 56.885, "total": 60.923, "mc": 4.037}], "id": "G.155. "}, {"ins_code": " ", "sesa": [{"sc": 14.5881, "total": 28.9038, "mc": 14.3157}], "name": "ALA", "chain": "G", "cv_coarse": [0.5510216549130523], "number": 156, "sap_score": [0.9162324461194208], "cv_fine": [0.7356199613186598], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 4.524, "total": 8.941, "mc": 4.417}], "id": "G.156. "}, {"ins_code": " ", "sesa": [{"sc": 52.4189, "total": 52.4189, "mc": 0.0}], "name": "LYS", "chain": "G", "cv_coarse": [0.5973887006179714], "number": 157, "sap_score": [-0.7517635672894928], "cv_fine": [0.7014428884255277], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 57.935, "total": 57.935, "mc": 0.0}], "id": "G.157. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 7.9339, "mc": 7.9339}], "name": "THR", "chain": "G", "cv_coarse": [0.7595732880851347], "number": 158, "sap_score": [-0.21689017369253316], "cv_fine": [0.8989285576902827], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 0.0, "total": 0.34, "mc": 0.34}], "id": "G.158. "}, {"ins_code": " ", "sesa": [{"sc": 27.7556, "total": 36.3966, "mc": 8.641}], "name": "PRO", "chain": "G", "cv_coarse": [0.7688324495096789], "number": 160, "sap_score": [0.44247830413290634], "cv_fine": [0.8624663900557298], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 12.104, "total": 14.835, "mc": 2.731}], "id": "G.160. "}, {"ins_code": " ", "sesa": [{"sc": 5.1339, "total": 10.499099999999999, "mc": 5.3652}], "name": "ILE", "chain": "G", "cv_coarse": [0.6634938773431576], "number": 161, "sap_score": [0.3467826392909007], "cv_fine": [0.9338108326318953], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 9.775, "total": 10.584, "mc": 0.809}], "id": "G.161. "}, {"ins_code": " ", "sesa": [{"sc": 34.8481, "total": 34.8481, "mc": 0.0}], "name": "GLN", "chain": "G", "cv_coarse": [0.577302825444789], "number": 162, "sap_score": [1.0028060027360293], "cv_fine": [0.8390918895463249], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 13.793, "total": 13.793, "mc": 0.0}], "id": "G.162. "}, {"ins_code": " ", "sesa": [{"sc": 57.126200000000004, "total": 58.79, "mc": 1.6638}], "name": "LYS", "chain": "G", "cv_coarse": [0.3971781857403785], "number": 164, "sap_score": [-0.854081692234709], "cv_fine": [0.7034352204789719], "name_short": "K", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LYSINE", "fasa": [{"sc": 61.108, "total": 61.108, "mc": 0.0}], "id": "G.164. "}, {"ins_code": " ", "sesa": [{"sc": 17.0732, "total": 41.6788, "mc": 24.6056}], "name": "VAL", "chain": "G", "cv_coarse": [0.3669092357995623], "number": 165, "sap_score": [0.3008136536626779], "cv_fine": [0.7930541321848625], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 8.795, "total": 37.332, "mc": 28.537}], "id": "G.165. "}, {"ins_code": " ", "sesa": [{"sc": 35.5532, "total": 56.2589, "mc": 20.7057}], "name": "SER", "chain": "G", "cv_coarse": [0.27831975739655784], "number": 166, "sap_score": [-0.06589375083265893], "cv_fine": [0.4849560902220671], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 47.841, "total": 75.961, "mc": 28.119}], "id": "G.166. "}, {"ins_code": " ", "sesa": [{"sc": 47.2821, "total": 47.2821, "mc": 0.0}], "name": "THR", "chain": "G", "cv_coarse": [0.2660413384449843], "number": 167, "sap_score": [0.170082145976648], "cv_fine": [0.5046300058458354], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 71.925, "total": 73.407, "mc": 1.482}], "id": "G.167. "}, {"ins_code": " ", "sesa": [{"sc": 49.8084, "total": 58.4258, "mc": 8.6174}], "name": "PRO", "chain": "G", "cv_coarse": [0.29559758630753546], "number": 168, "sap_score": [1.4119401410508008], "cv_fine": [0.5661717658212019], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 64.313, "total": 68.738, "mc": 4.425}], "id": "G.168. "}, {"ins_code": " ", "sesa": [{"sc": 45.1905, "total": 45.1905, "mc": 0.0}], "name": "PRO", "chain": "G", "cv_coarse": [0.2901877523031152], "number": 169, "sap_score": [1.55482724555754], "cv_fine": [0.6438886087223407], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 49.284, "total": 53.568, "mc": 4.283}], "id": "G.169. "}, {"ins_code": " ", "sesa": [{"sc": 41.775, "total": 44.5763, "mc": 2.8013}], "name": "PRO", "chain": "G", "cv_coarse": [0.24190110604215345], "number": 170, "sap_score": [1.2119400929845745], "cv_fine": [0.5403871231377939], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 51.83, "total": 52.118, "mc": 0.287}], "id": "G.170. "}, {"ins_code": " ", "sesa": [{"sc": 63.735299999999995, "total": 70.03410000000001, "mc": 6.2988}], "name": "PRO", "chain": "G", "cv_coarse": [0.23997411455074782], "number": 171, "sap_score": [0.45597810895563634], "cv_fine": [0.3874813704904393], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 104.196, "total": 105.236, "mc": 1.041}], "id": "G.171. "}, {"ins_code": " ", "sesa": [{"sc": 15.7576, "total": 37.7017, "mc": 21.9441}], "name": "GLY", "chain": "G", "cv_coarse": [0.28786865520815863], "number": 172, "sap_score": [-0.9413710635872803], "cv_fine": [0.5401990080748545], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 25.521, "total": 46.382, "mc": 20.862}], "id": "G.172. "}, {"ins_code": " ", "sesa": [{"sc": 6.4004, "total": 21.081, "mc": 14.6806}], "name": "THR", "chain": "G", "cv_coarse": [0.3295436366302165], "number": 173, "sap_score": [0.3092997920609201], "cv_fine": [0.8076131760001192], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 1.59, "total": 5.648, "mc": 4.058}], "id": "G.173. "}, {"ins_code": " ", "sesa": [{"sc": 28.0752, "total": 28.0752, "mc": 0.0}], "name": "ALA", "chain": "G", "cv_coarse": [0.3770294026926073], "number": 174, "sap_score": [0.19157801282391956], "cv_fine": [0.8560161721525962], "name_short": "A", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ALANINE", "fasa": [{"sc": 20.46, "total": 20.46, "mc": 0.0}], "id": "G.174. "}, {"ins_code": " ", "sesa": [{"sc": 9.3484, "total": 14.4927, "mc": 5.1443}], "name": "ILE", "chain": "G", "cv_coarse": [0.47065736263996216], "number": 175, "sap_score": [0.16198579357728876], "cv_fine": [0.9408340957606032], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 1.872, "total": 2.024, "mc": 0.151}], "id": "G.175. "}, {"ins_code": " ", "sesa": [{"sc": 47.0355, "total": 47.0355, "mc": 0.0}], "name": "ARG", "chain": "G", "cv_coarse": [0.3770255093494784], "number": 176, "sap_score": [-0.5645244790041597], "cv_fine": [0.8613546781456651], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 40.978, "total": 40.978, "mc": 0.0}], "id": "G.176. "}, {"ins_code": " ", "sesa": [{"sc": 35.5506, "total": 35.5506, "mc": 0.0}], "name": "MET", "chain": "G", "cv_coarse": [0.3584149971978233], "number": 178, "sap_score": [-0.1258174455652397], "cv_fine": [0.9094392498069729], "name_short": "M", "surface": [true], "secondary_structure": ["S"], "chemical_name": "METHIONINE", "fasa": [{"sc": 21.906, "total": 21.906, "mc": 0.0}], "id": "G.178. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 10.6252, "mc": 10.6252}], "name": "PRO", "chain": "G", "cv_coarse": [0.3731307546608996], "number": 179, "sap_score": [0.10802782970473983], "cv_fine": [0.9550629360488615], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 0.216, "total": 5.144, "mc": 4.928}], "id": "G.179. "}, {"ins_code": " ", "sesa": [{"sc": 45.525400000000005, "total": 45.525400000000005, "mc": 0.0}], "name": "VAL", "chain": "G", "cv_coarse": [0.2869158740424963], "number": 180, "sap_score": [0.28250327526663216], "cv_fine": [0.9126399516599407], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 15.874, "total": 15.874, "mc": 0.0}], "id": "G.180. "}, {"ins_code": " ", "sesa": [{"sc": 12.578800000000001, "total": 28.6797, "mc": 16.1009}], "name": "TYR", "chain": "G", "cv_coarse": [0.24168120166731333], "number": 181, "sap_score": [-0.10062523322212338], "cv_fine": [0.8955182291535034], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 2.222, "total": 8.127, "mc": 5.905}], "id": "G.181. "}, {"ins_code": " ", "sesa": [{"sc": 74.39890000000001, "total": 88.1752, "mc": 13.7763}], "name": "LYS", "chain": "G", "cv_coarse": [0.209474145075062], "number": 182, "sap_score": [-0.6125140563589707], "cv_fine": [0.5792770017665829], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 83.512, "total": 101.033, "mc": 17.521}], "id": "G.182. "}, {"ins_code": " ", "sesa": [{"sc": 74.29419999999999, "total": 77.8146, "mc": 3.5204}], "name": "LYS", "chain": "G", "cv_coarse": [0.16167601711588656], "number": 183, "sap_score": [-0.586223463624533], "cv_fine": [0.4737005996476768], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 104.963, "total": 105.117, "mc": 0.153}], "id": "G.183. "}, {"ins_code": " ", "sesa": [{"sc": 38.6442, "total": 58.318, "mc": 19.6738}], "name": "ALA", "chain": "G", "cv_coarse": [0.12917649427939712], "number": 184, "sap_score": [-0.8077954042286676], "cv_fine": [0.3957712109795312], "name_short": "A", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ALANINE", "fasa": [{"sc": 75.236, "total": 91.823, "mc": 16.587}], "id": "G.184. "}, {"ins_code": " ", "sesa": [{"sc": 72.084, "total": 90.37290000000002, "mc": 18.288899999999998}], "name": "GLU", "chain": "G", "cv_coarse": [0.11250505940468199], "number": 185, "sap_score": [-2.826991054231684], "cv_fine": [0.348220108487204], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 126.463, "total": 136.015, "mc": 9.553}], "id": "G.185. "}, {"ins_code": " ", "sesa": [{"sc": 34.7607, "total": 34.7607, "mc": 0.0}], "name": "HIS", "chain": "G", "cv_coarse": [0.15514971370916034], "number": 186, "sap_score": [-2.4949835384401946], "cv_fine": [0.6109914615240066], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 41.056, "total": 41.056, "mc": 0.0}], "id": "G.186. "}, {"ins_code": " ", "sesa": [{"sc": 53.8617, "total": 69.4641, "mc": 15.6024}], "name": "VAL", "chain": "G", "cv_coarse": [0.16863921741770513], "number": 187, "sap_score": [0.4425389949465622], "cv_fine": [0.7006710998313819], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 39.293, "total": 56.311, "mc": 17.018}], "id": "G.187. "}, {"ins_code": " ", "sesa": [{"sc": 59.4079, "total": 81.7114, "mc": 22.3035}], "name": "THR", "chain": "G", "cv_coarse": [0.13755050335086563], "number": 188, "sap_score": [-0.13406742841869831], "cv_fine": [0.4999812944912942], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 108.732, "total": 123.125, "mc": 14.392}], "id": "G.188. "}, {"ins_code": " ", "sesa": [{"sc": 52.1867, "total": 61.5762, "mc": 9.3895}], "name": "ASP", "chain": "G", "cv_coarse": [0.16363110577562628], "number": 189, "sap_score": [-0.18359300024730665], "cv_fine": [0.5591139040204876], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 68.791, "total": 69.832, "mc": 1.041}], "id": "G.189. "}, {"ins_code": " ", "sesa": [{"sc": 46.4, "total": 67.60629999999999, "mc": 21.2063}], "name": "VAL", "chain": "G", "cv_coarse": [0.21065065503786165], "number": 190, "sap_score": [1.441521725233992], "cv_fine": [0.6733207398467396], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 40.917, "total": 60.19, "mc": 19.274}], "id": "G.190. "}, {"ins_code": " ", "sesa": [{"sc": 17.1483, "total": 23.240000000000002, "mc": 6.0917}], "name": "VAL", "chain": "G", "cv_coarse": [0.28221874863262225], "number": 191, "sap_score": [1.417165480423552], "cv_fine": [0.8955539952632096], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 4.761, "total": 7.451, "mc": 2.69}], "id": "G.191. "}, {"ins_code": " ", "sesa": [{"sc": 60.548, "total": 71.0872, "mc": 10.539200000000001}], "name": "LYS", "chain": "G", "cv_coarse": [0.26111661766512334], "number": 192, "sap_score": [-0.32849225368954893], "cv_fine": [0.7178470756400227], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 76.335, "total": 78.774, "mc": 2.439}], "id": "G.192. "}, {"ins_code": " ", "sesa": [{"sc": 10.9099, "total": 26.8734, "mc": 15.9635}], "name": "ARG", "chain": "G", "cv_coarse": [0.3314775362067909], "number": 193, "sap_score": [-0.45133715166973626], "cv_fine": [0.8890456508238795], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 4.65, "total": 12.073, "mc": 7.423}], "id": "G.193. "}, {"ins_code": " ", "sesa": [{"sc": 10.3689, "total": 10.3689, "mc": 0.0}], "name": "CYS", "chain": "G", "cv_coarse": [0.254262261995069], "number": 194, "sap_score": [-0.29620925769805956], "cv_fine": [0.7463753550825517], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 1.189, "total": 1.189, "mc": 0.0}], "id": "G.194. "}, {"ins_code": " ", "sesa": [{"sc": 55.507999999999996, "total": 57.8349, "mc": 2.3269}], "name": "PRO", "chain": "G", "cv_coarse": [0.20461354323139083], "number": 195, "sap_score": [0.197481675754349], "cv_fine": [0.4879083720852414], "name_short": "P", "surface": [true], "secondary_structure": ["H"], "chemical_name": "PROLINE", "fasa": [{"sc": 34.413, "total": 34.432, "mc": 0.019}], "id": "G.195. "}, {"ins_code": " ", "sesa": [{"sc": 61.8414, "total": 79.55369999999999, "mc": 17.7123}], "name": "ASN", "chain": "G", "cv_coarse": [0.22197063458548869], "number": 196, "sap_score": [0.20883094390404547], "cv_fine": [0.45348902246992695], "name_short": "N", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 19.438, "total": 25.91, "mc": 6.473}], "id": "G.196. "}, {"ins_code": " ", "sesa": [{"sc": 44.22, "total": 49.7374, "mc": 5.5174}], "name": "HIS", "chain": "G", "cv_coarse": [0.31000588003545343], "number": 197, "sap_score": [-0.5906968071019976], "cv_fine": [0.735525194232784], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 48.067, "total": 51.542, "mc": 3.475}], "id": "G.197. "}, {"ins_code": " ", "sesa": [{"sc": 53.7607, "total": 61.125099999999996, "mc": 7.3644}], "name": "GLU", "chain": "G", "cv_coarse": [0.2504662023581078], "number": 198, "sap_score": [-0.39427144178974843], "cv_fine": [0.5730617447561167], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 69.74, "total": 74.449, "mc": 4.709}], "id": "G.198. "}, {"ins_code": " ", "sesa": [{"sc": 69.4271, "total": 84.9143, "mc": 15.4872}], "name": "LEU", "chain": "G", "cv_coarse": [0.22105873468799703], "number": 199, "sap_score": [1.6049303628597342], "cv_fine": [0.42065872096392537], "name_short": "L", "surface": [true], "secondary_structure": ["H"], "chemical_name": "LEUCINE", "fasa": [{"sc": 50.462, "total": 76.325, "mc": 25.863}], "id": "G.199. "}, {"ins_code": " ", "sesa": [{"sc": 18.8407, "total": 31.4563, "mc": 12.6156}], "name": "GLY", "chain": "G", "cv_coarse": [0.2700715974887554], "number": 200, "sap_score": [-0.7302766655629119], "cv_fine": [0.6185950519326984], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 21.522, "total": 27.288, "mc": 5.766}], "id": "G.200. "}, {"ins_code": " ", "sesa": [{"sc": 110.0958, "total": 129.5923, "mc": 19.4965}], "name": "ARG", "chain": "G", "cv_coarse": [0.2748356666507013], "number": 201, "sap_score": [-3.460905492356278], "cv_fine": [0.3940445667597807], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 143.685, "total": 157.159, "mc": 13.474}], "id": "G.201. "}, {"ins_code": " ", "sesa": [{"sc": 60.7838, "total": 81.5497, "mc": 20.765900000000002}], "name": "ASP", "chain": "G", "cv_coarse": [0.3469284636768116], "number": 202, "sap_score": [-2.1112638038891287], "cv_fine": [0.49570043290537147], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 90.368, "total": 109.074, "mc": 18.706}], "id": "G.202. "}, {"ins_code": " ", "sesa": [{"sc": 85.8273, "total": 96.1056, "mc": 10.2783}], "name": "PHE", "chain": "G", "cv_coarse": [0.4290933981843326], "number": 203, "sap_score": [0.8192553350985157], "cv_fine": [0.6989144418014921], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 98.007, "total": 100.558, "mc": 2.551}], "id": "G.203. "}, {"ins_code": " ", "sesa": [{"sc": 34.4614, "total": 47.865899999999996, "mc": 13.4045}], "name": "ASN", "chain": "G", "cv_coarse": [0.3281888727075125], "number": 204, "sap_score": [-0.9944439298837463], "cv_fine": [0.7140299666350983], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 20.088, "total": 33.562, "mc": 13.474}], "id": "G.204. "}, {"ins_code": " ", "sesa": [{"sc": 78.6912, "total": 97.31909999999999, "mc": 18.6279}], "name": "GLU", "chain": "G", "cv_coarse": [0.30155718882269056], "number": 205, "sap_score": [-2.8611279650099526], "cv_fine": [0.39355313816365295], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 105.81, "total": 126.933, "mc": 21.123}], "id": "G.205. "}, {"ins_code": " ", "sesa": [{"sc": 21.0758, "total": 52.060700000000004, "mc": 30.984900000000003}], "name": "GLY", "chain": "G", "cv_coarse": [0.39413389409822375], "number": 206, "sap_score": [-1.9977268142701392], "cv_fine": [0.4663972559441162], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 39.33, "total": 78.757, "mc": 39.426}], "id": "G.206. "}, {"ins_code": " ", "sesa": [{"sc": 57.884100000000004, "total": 75.4669, "mc": 17.5828}], "name": "GLN", "chain": "G", "cv_coarse": [0.43238409604627454], "number": 207, "sap_score": [-1.1966080407745558], "cv_fine": [0.6258972939946434], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 64.191, "total": 79.408, "mc": 15.217}], "id": "G.207. "}, {"ins_code": " ", "sesa": [{"sc": 42.7094, "total": 64.5669, "mc": 21.8575}], "name": "SER", "chain": "G", "cv_coarse": [0.3716524678568886], "number": 208, "sap_score": [-0.8547308339037191], "cv_fine": [0.47457369072034455], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 84.939, "total": 115.352, "mc": 30.412}], "id": "G.208. "}, {"ins_code": " ", "sesa": [{"sc": 12.191199999999998, "total": 26.2315, "mc": 14.0403}], "name": "ALA", "chain": "G", "cv_coarse": [0.39311348521487616], "number": 209, "sap_score": [0.011773923104814501], "cv_fine": [0.6538495006269709], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 5.817, "total": 13.249, "mc": 7.432}], "id": "G.209. "}, {"ins_code": " ", "sesa": [{"sc": 42.250699999999995, "total": 43.726499999999994, "mc": 1.4758}], "name": "PRO", "chain": "G", "cv_coarse": [0.3442177831776342], "number": 210, "sap_score": [0.6632369985233246], "cv_fine": [0.627784060133088], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 54.476, "total": 54.838, "mc": 0.363}], "id": "G.210. "}, {"ins_code": " ", "sesa": [{"sc": 22.953899999999997, "total": 30.8517, "mc": 7.8978}], "name": "ALA", "chain": "G", "cv_coarse": [0.3226600856538909], "number": 211, "sap_score": [0.3022597584091747], "cv_fine": [0.6969954553155413], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 24.743, "total": 31.447, "mc": 6.704}], "id": "G.211. "}, {"ins_code": " ", "sesa": [{"sc": 32.6066, "total": 38.2783, "mc": 5.6717}], "name": "SER", "chain": "G", "cv_coarse": [0.3013287220012888], "number": 212, "sap_score": [-0.4448532643987685], "cv_fine": [0.6824881330709679], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 23.224, "total": 25.19, "mc": 1.967}], "id": "G.212. "}, {"ins_code": " ", "sesa": [{"sc": 10.5702, "total": 10.5702, "mc": 0.0}], "name": "HIS", "chain": "G", "cv_coarse": [0.3686059960658604], "number": 213, "sap_score": [-0.07621716878420348], "cv_fine": [0.8468015952650555], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 3.093, "total": 3.093, "mc": 0.0}], "id": "G.213. "}, {"ins_code": " ", "sesa": [{"sc": 30.5037, "total": 30.5037, "mc": 0.0}], "name": "ARG", "chain": "G", "cv_coarse": [0.5160023710449347], "number": 216, "sap_score": [-0.11299184259382006], "cv_fine": [0.9037671726595158], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 6.117, "total": 6.117, "mc": 0.0}], "id": "G.216. "}, {"ins_code": " ", "sesa": [{"sc": 15.2685, "total": 33.6662, "mc": 18.3977}], "name": "VAL", "chain": "G", "cv_coarse": [0.6246402626255559], "number": 217, "sap_score": [-0.16048900889804404], "cv_fine": [0.8729455715526068], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 3.641, "total": 15.948, "mc": 12.308}], "id": "G.217. "}, {"ins_code": " ", "sesa": [{"sc": 36.2238, "total": 44.2914, "mc": 8.0676}], "name": "GLU", "chain": "G", "cv_coarse": [0.7170969155682551], "number": 218, "sap_score": [-0.29241702246770707], "cv_fine": [0.803661206954795], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 28.887, "total": 30.617, "mc": 1.73}], "id": "G.218. "}, {"ins_code": " ", "sesa": [{"sc": 16.1852, "total": 33.5986, "mc": 17.4134}], "name": "GLY", "chain": "G", "cv_coarse": [0.6687226485819076], "number": 219, "sap_score": [0.14185745285425225], "cv_fine": [0.8362187613020411], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 15.697, "total": 27.755, "mc": 12.057}], "id": "G.219. "}, {"ins_code": " ", "sesa": [{"sc": 43.9855, "total": 61.7952, "mc": 17.8097}], "name": "ASN", "chain": "G", "cv_coarse": [0.577994872537827], "number": 220, "sap_score": [-0.8086495253062261], "cv_fine": [0.7562760307400243], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 38.289, "total": 49.071, "mc": 10.783}], "id": "G.220. "}, {"ins_code": " ", "sesa": [{"sc": 66.11420000000001, "total": 96.20769999999999, "mc": 30.0935}], "name": "ASN", "chain": "G", "cv_coarse": [0.4632276670956752], "number": 221, "sap_score": [-1.315176446848534], "cv_fine": [0.5901774817182751], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 128.343, "total": 153.694, "mc": 25.352}], "id": "G.221. "}, {"ins_code": " ", "sesa": [{"sc": 75.8081, "total": 83.4939, "mc": 7.6858}], "name": "LEU", "chain": "G", "cv_coarse": [0.4119527321080573], "number": 222, "sap_score": [1.0743539167781129], "cv_fine": [0.45071706232798087], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 118.527, "total": 120.34, "mc": 1.813}], "id": "G.222. "}, {"ins_code": " ", "sesa": [{"sc": 10.9323, "total": 24.1997, "mc": 13.2674}], "name": "SER", "chain": "G", "cv_coarse": [0.4574772646933167], "number": 223, "sap_score": [-0.09174222460669301], "cv_fine": [0.7337461395617214], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 7.936, "total": 19.146, "mc": 11.209}], "id": "G.223. "}, {"ins_code": " ", "sesa": [{"sc": 68.7435, "total": 68.7435, "mc": 0.0}], "name": "GLN", "chain": "G", "cv_coarse": [0.3679190771896585], "number": 224, "sap_score": [-0.3904998671419558], "cv_fine": [0.5340074444598248], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 94.115, "total": 94.115, "mc": 0.0}], "id": "G.224. "}, {"ins_code": " ", "sesa": [{"sc": 30.084, "total": 55.5236, "mc": 25.4396}], "name": "TYR", "chain": "G", "cv_coarse": [0.41875201027286746], "number": 225, "sap_score": [0.5904586302116203], "cv_fine": [0.7619778445734217], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 17.427, "total": 44.317, "mc": 26.89}], "id": "G.225. "}, {"ins_code": " ", "sesa": [{"sc": 41.3658, "total": 41.3658, "mc": 0.0}], "name": "VAL", "chain": "G", "cv_coarse": [0.30969195952827505], "number": 226, "sap_score": [0.20896126933782697], "cv_fine": [0.6772767464278778], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 45.406, "total": 45.406, "mc": 0.0}], "id": "G.226. "}, {"ins_code": " ", "sesa": [{"sc": 47.9856, "total": 65.0795, "mc": 17.0939}], "name": "ASP", "chain": "G", "cv_coarse": [0.24412618332258537], "number": 227, "sap_score": [-1.2291373988075562], "cv_fine": [0.5907292680635658], "name_short": "D", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 59.111, "total": 73.104, "mc": 13.993}], "id": "G.227. "}, {"ins_code": " ", "sesa": [{"sc": 40.718, "total": 45.2686, "mc": 4.5506}], "name": "ASP", "chain": "G", "cv_coarse": [0.21563185023955225], "number": 228, "sap_score": [-0.518835658515922], "cv_fine": [0.637528827669321], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 36.486, "total": 38.258, "mc": 1.772}], "id": "G.228. "}, {"ins_code": " ", "sesa": [{"sc": 64.1612, "total": 82.21079999999999, "mc": 18.0496}], "name": "PRO", "chain": "G", "cv_coarse": [0.16935529915503286], "number": 229, "sap_score": [1.4739700071921478], "cv_fine": [0.320652625666353], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 103.907, "total": 134.711, "mc": 30.804}], "id": "G.229. "}, {"ins_code": " ", "sesa": [{"sc": 69.3386, "total": 84.9592, "mc": 15.6206}], "name": "VAL", "chain": "G", "cv_coarse": [0.14208582118626914], "number": 230, "sap_score": [1.7579614232876963], "cv_fine": [0.33440092681355527], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 117.568, "total": 143.876, "mc": 26.308}], "id": "G.230. "}, {"ins_code": " ", "sesa": [{"sc": 32.66330000000001, "total": 47.988200000000006, "mc": 15.3249}], "name": "THR", "chain": "G", "cv_coarse": [0.1712612029724722], "number": 231, "sap_score": [-0.27937049577291373], "cv_fine": [0.640060620406717], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 24.531, "total": 41.534, "mc": 17.004}], "id": "G.231. "}, {"ins_code": " ", "sesa": [{"sc": 14.8024, "total": 23.6452, "mc": 8.8428}], "name": "GLY", "chain": "G", "cv_coarse": [0.20535202001382544], "number": 232, "sap_score": [-0.14180068800184478], "cv_fine": [0.6804572542353741], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 17.841, "total": 19.035, "mc": 1.194}], "id": "G.232. "}, {"ins_code": " ", "sesa": [{"sc": 71.86710000000001, "total": 80.22210000000001, "mc": 8.355}], "name": "ARG", "chain": "G", "cv_coarse": [0.22933978718829015], "number": 233, "sap_score": [-1.2117989255064927], "cv_fine": [0.8079620149917343], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 48.387, "total": 49.108, "mc": 0.721}], "id": "G.233. "}, {"ins_code": " ", "sesa": [{"sc": 11.6734, "total": 14.2917, "mc": 2.6183}], "name": "GLN", "chain": "G", "cv_coarse": [0.3246357173789026], "number": 234, "sap_score": [0.09668830165589087], "cv_fine": [0.9008631381805989], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 5.104, "total": 5.104, "mc": 0.0}], "id": "G.234. "}, {"ins_code": " ", "sesa": [{"sc": 13.1131, "total": 13.1131, "mc": 0.0}], "name": "SER", "chain": "G", "cv_coarse": [0.37510399470089695], "number": 235, "sap_score": [-0.1050812385463156], "cv_fine": [0.8858264768081688], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 4.06, "total": 4.634, "mc": 0.574}], "id": "G.235. "}, {"ins_code": " ", "sesa": [{"sc": 32.376400000000004, "total": 32.376400000000004, "mc": 0.0}], "name": "VAL", "chain": "G", "cv_coarse": [0.41840428755740067], "number": 237, "sap_score": [0.15006212684358838], "cv_fine": [0.810493532371886], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 20.443, "total": 20.716, "mc": 0.273}], "id": "G.237. "}, {"ins_code": " ", "sesa": [{"sc": 24.430799999999998, "total": 27.1291, "mc": 2.6983}], "name": "VAL", "chain": "G", "cv_coarse": [0.4935238589414651], "number": 238, "sap_score": [0.2851511038135003], "cv_fine": [0.8598145025646929], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 11.402, "total": 11.893, "mc": 0.491}], "id": "G.238. "}, {"ins_code": " ", "sesa": [{"sc": 53.555, "total": 66.2004, "mc": 12.6454}], "name": "PRO", "chain": "G", "cv_coarse": [0.4326125420600982], "number": 239, "sap_score": [0.6626569572723795], "cv_fine": [0.7224152529623548], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 55.865, "total": 60.567, "mc": 4.701}], "id": "G.239. "}, {"ins_code": " ", "sesa": [{"sc": 27.168800000000005, "total": 44.2436, "mc": 17.0748}], "name": "TYR", "chain": "G", "cv_coarse": [0.42604790005850024], "number": 240, "sap_score": [0.5817499497511295], "cv_fine": [0.8173814500724554], "name_short": "Y", "surface": [true], "secondary_structure": ["L"], "chemical_name": "TYROSINE", "fasa": [{"sc": 9.968, "total": 29.883, "mc": 19.915}], "id": "G.240. "}, {"ins_code": " ", "sesa": [{"sc": 66.5649, "total": 72.6283, "mc": 6.0634}], "name": "GLU", "chain": "G", "cv_coarse": [0.48636880454428627], "number": 241, "sap_score": [-1.00126761106863], "cv_fine": [0.6793643544563994], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 90.35, "total": 91.8, "mc": 1.449}], "id": "G.241. "}, {"ins_code": " ", "sesa": [{"sc": 49.7357, "total": 49.7357, "mc": 0.0}], "name": "PRO", "chain": "G", "cv_coarse": [0.43999688531094533], "number": 242, "sap_score": [-0.44562124701460243], "cv_fine": [0.647442523860383], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 62.802, "total": 62.802, "mc": 0.0}], "id": "G.242. "}, {"ins_code": " ", "sesa": [{"sc": 25.9135, "total": 41.6442, "mc": 15.7307}], "name": "PRO", "chain": "G", "cv_coarse": [0.4833166956670422], "number": 243, "sap_score": [-0.41169349448903964], "cv_fine": [0.7480212605747293], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 21.688, "total": 35.008, "mc": 13.319}], "id": "G.243. "}, {"ins_code": " ", "sesa": [{"sc": 85.9836, "total": 101.8999, "mc": 15.9163}], "name": "GLN", "chain": "G", "cv_coarse": [0.5410244889810065], "number": 244, "sap_score": [-0.8254491221866813], "cv_fine": [0.765962238690993], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 79.936, "total": 83.9, "mc": 3.964}], "id": "G.244. "}, {"ins_code": " ", "sesa": [{"sc": 71.1107, "total": 92.0945, "mc": 20.983800000000002}], "name": "VAL", "chain": "G", "cv_coarse": [0.44125440197844285], "number": 245, "sap_score": [0.9425945015575069], "cv_fine": [0.6197651167343571], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 99.044, "total": 110.121, "mc": 11.077}], "id": "G.245. "}, {"ins_code": " ", "sesa": [{"sc": 20.7185, "total": 49.381, "mc": 28.6625}], "name": "GLY", "chain": "G", "cv_coarse": [0.42568249015567367], "number": 246, "sap_score": [0.404625348658896], "cv_fine": [0.49501900998461185], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 37.244, "total": 84.14, "mc": 46.896}], "id": "G.246. "}, {"ins_code": " ", "sesa": [{"sc": 50.5288, "total": 65.9828, "mc": 15.454}], "name": "THR", "chain": "G", "cv_coarse": [0.49838065292115624], "number": 247, "sap_score": [-1.0465882051108066], "cv_fine": [0.6591848372538892], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 38.577, "total": 53.56, "mc": 14.984}], "id": "G.247. "}, {"ins_code": " ", "sesa": [{"sc": 55.0389, "total": 72.4736, "mc": 17.4347}], "name": "GLU", "chain": "G", "cv_coarse": [0.4387508500203073], "number": 248, "sap_score": [-1.7007471900551379], "cv_fine": [0.5434234684554985], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 79.398, "total": 88.702, "mc": 9.304}], "id": "G.248. "}, {"ins_code": " ", "sesa": [{"sc": 50.5187, "total": 61.0852, "mc": 10.5665}], "name": "PHE", "chain": "G", "cv_coarse": [0.5376873037402417], "number": 249, "sap_score": [-0.10676607093675097], "cv_fine": [0.6911437149241055], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 59.604, "total": 63.737, "mc": 4.133}], "id": "G.249. "}, {"ins_code": " ", "sesa": [{"sc": 34.4275, "total": 34.4275, "mc": 0.0}], "name": "THR", "chain": "G", "cv_coarse": [0.6081431772150854], "number": 250, "sap_score": [-0.22416764853899018], "cv_fine": [0.8595658090028283], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 21.422, "total": 21.422, "mc": 0.0}], "id": "G.250. "}, {"ins_code": " ", "sesa": [{"sc": 52.8519, "total": 75.1354, "mc": 22.2835}], "name": "THR", "chain": "G", "cv_coarse": [0.7363309051659422], "number": 251, "sap_score": [0.10229246156846553], "cv_fine": [0.8459823549494369], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 52.016, "total": 70.871, "mc": 18.855}], "id": "G.251. "}, {"ins_code": " ", "sesa": [{"sc": 25.677, "total": 25.677, "mc": 0.0}], "name": "ILE", "chain": "G", "cv_coarse": [0.7057639691366042], "number": 252, "sap_score": [0.5887391537717608], "cv_fine": [0.9031113023406572], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 15.195, "total": 15.195, "mc": 0.0}], "id": "G.252. "}, {"ins_code": " ", "sesa": [{"sc": 34.6552, "total": 39.2197, "mc": 4.5645}], "name": "LEU", "chain": "G", "cv_coarse": [0.8082763412039892], "number": 253, "sap_score": [0.36472494814057044], "cv_fine": [0.857259183985685], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 14.011, "total": 14.91, "mc": 0.899}], "id": "G.253. "}, {"ins_code": " ", "sesa": [{"sc": 26.1438, "total": 26.1438, "mc": 0.0}], "name": "ASN", "chain": "G", "cv_coarse": [0.6202300726390984], "number": 255, "sap_score": [-0.2730402738738259], "cv_fine": [0.9000484926340844], "name_short": "N", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 13.898, "total": 13.898, "mc": 0.0}], "id": "G.255. "}, {"ins_code": " ", "sesa": [{"sc": 17.9129, "total": 26.871000000000002, "mc": 8.9581}], "name": "MET", "chain": "G", "cv_coarse": [0.46511833482326836], "number": 257, "sap_score": [0.20092535996783925], "cv_fine": [0.9108489948733086], "name_short": "M", "surface": [true], "secondary_structure": ["L"], "chemical_name": "METHIONINE", "fasa": [{"sc": 4.243, "total": 6.338, "mc": 2.095}], "id": "G.257. "}, {"ins_code": " ", "sesa": [{"sc": 35.0495, "total": 35.0495, "mc": 0.0}], "name": "ASN", "chain": "G", "cv_coarse": [0.35310028441302477], "number": 259, "sap_score": [0.3307260391393305], "cv_fine": [0.7659745888642742], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 26.319, "total": 26.319, "mc": 0.0}], "id": "G.259. "}, {"ins_code": " ", "sesa": [{"sc": 25.955199999999998, "total": 28.3876, "mc": 2.4324}], "name": "SER", "chain": "G", "cv_coarse": [0.3143315969873479], "number": 260, "sap_score": [-0.23974558966780923], "cv_fine": [0.8449690372155564], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 8.12, "total": 8.301, "mc": 0.181}], "id": "G.260. "}, {"ins_code": " ", "sesa": [{"sc": 38.9988, "total": 53.4383, "mc": 14.439499999999999}], "name": "SER", "chain": "G", "cv_coarse": [0.2622039816349915], "number": 261, "sap_score": [-0.48650688862310204], "cv_fine": [0.603689021803913], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 45.915, "total": 52.367, "mc": 6.452}], "id": "G.261. "}, {"ins_code": " ", "sesa": [{"sc": 20.7683, "total": 20.7683, "mc": 0.0}], "name": "CYS", "chain": "G", "cv_coarse": [0.25933656452405635], "number": 262, "sap_score": [0.3512912442898571], "cv_fine": [0.7055906112889542], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 15.084, "total": 15.141, "mc": 0.057}], "id": "G.262. "}, {"ins_code": " ", "sesa": [{"sc": 64.54990000000001, "total": 78.5767, "mc": 14.026800000000001}], "name": "VAL", "chain": "G", "cv_coarse": [0.19316093736107565], "number": 263, "sap_score": [0.6603544297234543], "cv_fine": [0.47068211520195913], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 62.088, "total": 64.785, "mc": 2.697}], "id": "G.263. "}, {"ins_code": " ", "sesa": [{"sc": 18.1355, "total": 40.335, "mc": 22.1995}], "name": "GLY", "chain": "G", "cv_coarse": [0.188250259473089], "number": 264, "sap_score": [0.40186702595607776], "cv_fine": [0.5158339720392883], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 21.365, "total": 51.642, "mc": 30.277}], "id": "G.264. "}, {"ins_code": " ", "sesa": [{"sc": 10.0642, "total": 21.692800000000002, "mc": 11.6286}], "name": "GLY", "chain": "G", "cv_coarse": [0.22492681357837366], "number": 265, "sap_score": [-0.14737214431630843], "cv_fine": [0.7191261286926787], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 7.123, "total": 9.294, "mc": 2.171}], "id": "G.265. "}, {"ins_code": " ", "sesa": [{"sc": 48.090999999999994, "total": 54.911699999999996, "mc": 6.8207}], "name": "ASN", "chain": "G", "cv_coarse": [0.18924951130101283], "number": 267, "sap_score": [-1.0834856915712703], "cv_fine": [0.5570172587280939], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 63.323, "total": 67.78, "mc": 4.458}], "id": "G.267. "}, {"ins_code": " ", "sesa": [{"sc": 96.14340000000001, "total": 117.8331, "mc": 21.689700000000002}], "name": "ARG", "chain": "G", "cv_coarse": [0.19509321537962496], "number": 268, "sap_score": [-3.0296719527539633], "cv_fine": [0.42907715284350717], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 142.627, "total": 166.193, "mc": 23.566}], "id": "G.268. "}, {"ins_code": " ", "sesa": [{"sc": 53.772800000000004, "total": 56.766999999999996, "mc": 2.9942}], "name": "ARG", "chain": "G", "cv_coarse": [0.20051396359344925], "number": 269, "sap_score": [-1.1045053054392369], "cv_fine": [0.6994292647515591], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 45.821, "total": 45.821, "mc": 0.0}], "id": "G.269. "}, {"ins_code": " ", "sesa": [{"sc": 61.00280000000001, "total": 67.9248, "mc": 6.922}], "name": "PRO", "chain": "G", "cv_coarse": [0.24807004077503741], "number": 270, "sap_score": [0.006102575220492068], "cv_fine": [0.6986985852711797], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 55.295, "total": 55.687, "mc": 0.392}], "id": "G.270. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 6.4861, "mc": 6.4861}], "name": "ILE", "chain": "G", "cv_coarse": [0.34157462827370577], "number": 271, "sap_score": [0.2539497086558517], "cv_fine": [0.9440038279717017], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 0.031, "total": 0.032, "mc": 0.001}], "id": "G.271. "}, {"ins_code": " ", "sesa": [{"sc": 34.3964, "total": 34.3964, "mc": 0.0}], "name": "LEU", "chain": "G", "cv_coarse": [0.3168936898615645], "number": 272, "sap_score": [-0.3732380967942197], "cv_fine": [0.8584216238118041], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 8.158, "total": 8.158, "mc": 0.0}], "id": "G.272. "}, {"ins_code": " ", "sesa": [{"sc": 31.468000000000004, "total": 31.468000000000004, "mc": 0.0}], "name": "ILE", "chain": "G", "cv_coarse": [0.3720587510863373], "number": 274, "sap_score": [0.060632364549817463], "cv_fine": [0.9283639714537963], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 5.566, "total": 5.566, "mc": 0.0}], "id": "G.274. "}, {"ins_code": " ", "sesa": [{"sc": 16.8521, "total": 16.8521, "mc": 0.0}], "name": "THR", "chain": "G", "cv_coarse": [0.36589841706446397], "number": 276, "sap_score": [0.01888087365621303], "cv_fine": [0.9152878600801506], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 6.724, "total": 6.724, "mc": 0.0}], "id": "G.276. "}, {"ins_code": " ", "sesa": [{"sc": 35.7362, "total": 38.0236, "mc": 2.2874}], "name": "GLU", "chain": "G", "cv_coarse": [0.3007141492724703], "number": 278, "sap_score": [-0.6415815746109236], "cv_fine": [0.8022607099515257], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 20.133, "total": 20.152, "mc": 0.018}], "id": "G.278. "}, {"ins_code": " ", "sesa": [{"sc": 52.3651, "total": 60.9608, "mc": 8.595699999999999}], "name": "MET", "chain": "G", "cv_coarse": [0.2383859528998408], "number": 279, "sap_score": [-0.11711323116853296], "cv_fine": [0.6669985408013924], "name_short": "M", "surface": [true], "secondary_structure": ["L"], "chemical_name": "METHIONINE", "fasa": [{"sc": 52.963, "total": 55.447, "mc": 2.484}], "id": "G.279. "}, {"ins_code": " ", "sesa": [{"sc": 99.6337, "total": 121.5344, "mc": 21.9007}], "name": "ARG", "chain": "G", "cv_coarse": [0.2263680462156203], "number": 280, "sap_score": [-3.392336927494845], "cv_fine": [0.4209850463921276], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 142.889, "total": 174.348, "mc": 31.46}], "id": "G.280. "}, {"ins_code": " ", "sesa": [{"sc": 55.5378, "total": 77.6399, "mc": 22.1021}], "name": "ASP", "chain": "G", "cv_coarse": [0.1854257979823858], "number": 281, "sap_score": [-3.876563442541533], "cv_fine": [0.3747430952172289], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 84.028, "total": 118.272, "mc": 34.244}], "id": "G.281. "}, {"ins_code": " ", "sesa": [{"sc": 14.0791, "total": 30.083199999999998, "mc": 16.0041}], "name": "GLY", "chain": "G", "cv_coarse": [0.2182681063367795], "number": 282, "sap_score": [-2.4904217813255176], "cv_fine": [0.5113418994772201], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 18.443, "total": 33.964, "mc": 15.521}], "id": "G.282. "}, {"ins_code": " ", "sesa": [{"sc": 80.7549, "total": 85.7765, "mc": 5.0216}], "name": "GLN", "chain": "G", "cv_coarse": [0.18580446749181265], "number": 283, "sap_score": [-1.180833303096248], "cv_fine": [0.42774670008231697], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 128.764, "total": 130.577, "mc": 1.813}], "id": "G.283. "}, {"ins_code": " ", "sesa": [{"sc": 36.1158, "total": 58.5257, "mc": 22.4099}], "name": "VAL", "chain": "G", "cv_coarse": [0.23370281853584393], "number": 284, "sap_score": [1.4592429455773652], "cv_fine": [0.6403304529839629], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 40.966, "total": 61.75, "mc": 20.784}], "id": "G.284. "}, {"ins_code": " ", "sesa": [{"sc": 32.6127, "total": 35.6215, "mc": 3.0088}], "name": "LEU", "chain": "G", "cv_coarse": [0.2530716343974746], "number": 285, "sap_score": [1.3894665633606575], "cv_fine": [0.7495317360977682], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 20.156, "total": 21.074, "mc": 0.919}], "id": "G.285. "}, {"ins_code": " ", "sesa": [{"sc": 32.0524, "total": 32.0524, "mc": 0.0}], "name": "ARG", "chain": "G", "cv_coarse": [0.2804985527080295], "number": 287, "sap_score": [-0.7473135484447605], "cv_fine": [0.7960885321210758], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 22.854, "total": 22.854, "mc": 0.0}], "id": "G.287. "}, {"ins_code": " ", "sesa": [{"sc": 42.250099999999996, "total": 42.250099999999996, "mc": 0.0}], "name": "ARG", "chain": "G", "cv_coarse": [0.3355950817333508], "number": 288, "sap_score": [-0.5620376193377424], "cv_fine": [0.7793939678853262], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 31.969, "total": 32.086, "mc": 0.117}], "id": "G.288. "}, {"ins_code": " ", "sesa": [{"sc": 10.4068, "total": 16.7517, "mc": 6.3449}], "name": "SER", "chain": "G", "cv_coarse": [0.3447030365524335], "number": 289, "sap_score": [-0.34673328006932613], "cv_fine": [0.8454918854574638], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 3.849, "total": 6.401, "mc": 2.552}], "id": "G.289. "}, {"ins_code": " ", "sesa": [{"sc": 14.753499999999999, "total": 15.862400000000001, "mc": 1.1089}], "name": "PHE", "chain": "G", "cv_coarse": [0.4298030212483063], "number": 290, "sap_score": [0.200567764622049], "cv_fine": [0.9332537291829279], "name_short": "F", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 7.058, "total": 7.209, "mc": 0.151}], "id": "G.290. "}, {"ins_code": " ", "sesa": [{"sc": 51.169799999999995, "total": 55.433099999999996, "mc": 4.2633}], "name": "GLU", "chain": "G", "cv_coarse": [0.3220239512376696], "number": 291, "sap_score": [-0.28795179704047724], "cv_fine": [0.7493951479962088], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 36.245, "total": 37.865, "mc": 1.62}], "id": "G.291. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 11.8988, "mc": 11.8988}], "name": "GLY", "chain": "G", "cv_coarse": [0.391445448764151], "number": 292, "sap_score": [-0.15825006858747243], "cv_fine": [0.9510402214816271], "name_short": "G", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLYCINE", "fasa": [{"sc": 3.164, "total": 4.315, "mc": 1.15}], "id": "G.292. "}, {"ins_code": " ", "sesa": [{"sc": 71.51570000000001, "total": 71.51570000000001, "mc": 0.0}], "name": "ARG", "chain": "G", "cv_coarse": [0.3434411443480314], "number": 293, "sap_score": [-0.955092873015229], "cv_fine": [0.7981359563738596], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 87.243, "total": 87.597, "mc": 0.353}], "id": "G.293. "}, {"ins_code": " ", "sesa": [{"sc": 23.3461, "total": 26.0332, "mc": 2.6871}], "name": "CYS", "chain": "G", "cv_coarse": [0.370268363161321], "number": 295, "sap_score": [-0.14326264664460364], "cv_fine": [0.7498493740455178], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 8.909, "total": 8.911, "mc": 0.002}], "id": "G.295. "}, {"ins_code": " ", "sesa": [{"sc": 40.8329, "total": 59.2586, "mc": 18.4257}], "name": "ALA", "chain": "G", "cv_coarse": [0.34601508448047336], "number": 296, "sap_score": [0.38804434887069533], "cv_fine": [0.4991835570387953], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 63.179, "total": 75.854, "mc": 12.676}], "id": "G.296. "}, {"ins_code": " ", "sesa": [{"sc": 41.368399999999994, "total": 46.7136, "mc": 5.3452}], "name": "CYS", "chain": "G", "cv_coarse": [0.33371007369522326], "number": 297, "sap_score": [-0.5038451836655138], "cv_fine": [0.5645736794287712], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 48.88, "total": 49.495, "mc": 0.615}], "id": "G.297. "}, {"ins_code": " ", "sesa": [{"sc": 7.4786, "total": 7.4786, "mc": 0.0}], "name": "PRO", "chain": "G", "cv_coarse": [0.40759725507122985], "number": 298, "sap_score": [-0.03175557930500716], "cv_fine": [0.8313637068748239], "name_short": "P", "surface": [true], "secondary_structure": ["H"], "chemical_name": "PROLINE", "fasa": [{"sc": 1.515, "total": 1.515, "mc": 0.0}], "id": "G.298. "}, {"ins_code": " ", "sesa": [{"sc": 11.0742, "total": 22.9956, "mc": 11.921399999999998}], "name": "GLY", "chain": "G", "cv_coarse": [0.34990385572377536], "number": 299, "sap_score": [-0.6596915996498508], "cv_fine": [0.7486168374857536], "name_short": "G", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLYCINE", "fasa": [{"sc": 4.704, "total": 9.305, "mc": 4.601}], "id": "G.299. "}, {"ins_code": " ", "sesa": [{"sc": 92.3629, "total": 101.4997, "mc": 9.136800000000001}], "name": "ARG", "chain": "G", "cv_coarse": [0.2637557154399954], "number": 300, "sap_score": [-1.9649591902641468], "cv_fine": [0.4638546934421783], "name_short": "R", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ARGININE", "fasa": [{"sc": 127.724, "total": 129.509, "mc": 1.785}], "id": "G.300. "}, {"ins_code": " ", "sesa": [{"sc": 30.640700000000002, "total": 34.1397, "mc": 3.499}], "name": "ASP", "chain": "G", "cv_coarse": [0.2941555654619033], "number": 301, "sap_score": [-1.283908530826973], "cv_fine": [0.6843083196655824], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 16.975, "total": 17.25, "mc": 0.275}], "id": "G.301. "}, {"ins_code": " ", "sesa": [{"sc": 54.9145, "total": 54.9145, "mc": 0.0}], "name": "ARG", "chain": "G", "cv_coarse": [0.3425531652889154], "number": 302, "sap_score": [-0.8091353467632738], "cv_fine": [0.7798343905466666], "name_short": "R", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ARGININE", "fasa": [{"sc": 47.297, "total": 47.297, "mc": 0.0}], "id": "G.302. "}, {"ins_code": " ", "sesa": [{"sc": 90.8121, "total": 95.13080000000001, "mc": 4.3187}], "name": "LYS", "chain": "G", "cv_coarse": [0.24806161006754598], "number": 303, "sap_score": [-1.1195214697105793], "cv_fine": [0.5562256917837143], "name_short": "K", "surface": [true], "secondary_structure": ["H"], "chemical_name": "LYSINE", "fasa": [{"sc": 125.865, "total": 126.062, "mc": 0.197}], "id": "G.303. "}, {"ins_code": " ", "sesa": [{"sc": 35.0379, "total": 46.0136, "mc": 10.9757}], "name": "ALA", "chain": "G", "cv_coarse": [0.22018593363042135], "number": 304, "sap_score": [-1.5854115146859302], "cv_fine": [0.6182231904721853], "name_short": "A", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ALANINE", "fasa": [{"sc": 48.695, "total": 54.213, "mc": 5.518}], "id": "G.304. "}, {"ins_code": " ", "sesa": [{"sc": 44.4786, "total": 51.8481, "mc": 7.3695}], "name": "ASP", "chain": "G", "cv_coarse": [0.2364456640980599], "number": 305, "sap_score": [-0.9618616488100322], "cv_fine": [0.6802746322080901], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 44.481, "total": 46.677, "mc": 2.196}], "id": "G.305. "}, {"ins_code": " ", "sesa": [{"sc": 38.9204, "total": 45.824600000000004, "mc": 6.9041999999999994}], "name": "GLU", "chain": "G", "cv_coarse": [0.2481095067030577], "number": 306, "sap_score": [-1.2927386698382204], "cv_fine": [0.7278073446121649], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 42.131, "total": 43.992, "mc": 1.86}], "id": "G.306. "}, {"ins_code": " ", "sesa": [{"sc": 56.5537, "total": 68.5997, "mc": 12.046000000000001}], "name": "ASP", "chain": "G", "cv_coarse": [0.18404720021548882], "number": 307, "sap_score": [-2.479878112777913], "cv_fine": [0.500442418975297], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 82.576, "total": 95.229, "mc": 12.653}], "id": "G.307. "}, {"ins_code": " ", "sesa": [{"sc": 83.61040000000001, "total": 96.42320000000001, "mc": 12.8128}], "name": "HIS", "chain": "G", "cv_coarse": [0.15553083859988842], "number": 308, "sap_score": [-2.309795423254726], "cv_fine": [0.3682921603501437], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 145.136, "total": 153.654, "mc": 8.519}], "id": "G.308. "}, {"ins_code": " ", "sesa": [{"sc": 62.1232, "total": 80.2134, "mc": 18.0902}], "name": "TYR", "chain": "G", "cv_coarse": [0.17942469999064556], "number": 309, "sap_score": [-1.2792306316841595], "cv_fine": [0.508955161318586], "name_short": "Y", "surface": [true], "secondary_structure": ["H"], "chemical_name": "TYROSINE", "fasa": [{"sc": 64.461, "total": 91.038, "mc": 26.577}], "id": "G.309. "}, {"ins_code": " ", "sesa": [{"sc": 96.97699999999999, "total": 126.26839999999999, "mc": 29.291400000000003}], "name": "ARG", "chain": "G", "cv_coarse": [0.1513357944758372], "number": 310, "sap_score": [-3.048746192548344], "cv_fine": [0.29995970255685406], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 159.751, "total": 218.888, "mc": 59.136}], "id": "G.310. "}, {"ins_code": " ", "sesa": [{"sc": 42.9576, "total": 79.9342, "mc": 36.976600000000005}], "name": "GLU", "chain": "H", "cv_coarse": [0.5588073703470965], "number": 113, "sap_score": [-2.624265697445133], "cv_fine": [0.6408904219351634], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 80.242, "total": 106.693, "mc": 26.451}], "id": "H.113. "}, {"ins_code": " ", "sesa": [{"sc": 30.4095, "total": 52.075199999999995, "mc": 21.6657}], "name": "PHE", "chain": "H", "cv_coarse": [0.6242357155499734], "number": 114, "sap_score": [-0.37202718546542357], "cv_fine": [0.8113820909133066], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 44.221, "total": 52.644, "mc": 8.423}], "id": "H.114. "}, {"ins_code": " ", "sesa": [{"sc": 78.041, "total": 95.3225, "mc": 17.2815}], "name": "ILE", "chain": "H", "cv_coarse": [0.7402766404632843], "number": 115, "sap_score": [1.4778887661249256], "cv_fine": [0.9006721713756682], "name_short": "I", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 56.494, "total": 61.626, "mc": 5.133}], "id": "H.115. "}, {"ins_code": " ", "sesa": [{"sc": 48.5268, "total": 64.8041, "mc": 16.2773}], "name": "PRO", "chain": "H", "cv_coarse": [0.7607013968465292], "number": 116, "sap_score": [0.5960204292047304], "cv_fine": [0.8535437478838143], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 17.55, "total": 28.865, "mc": 11.315}], "id": "H.116. "}, {"ins_code": " ", "sesa": [{"sc": 29.6511, "total": 48.5628, "mc": 18.9117}], "name": "SER", "chain": "H", "cv_coarse": [0.6938940945671631], "number": 117, "sap_score": [-0.48107926012803964], "cv_fine": [0.8713457427927085], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 18.592, "total": 23.045, "mc": 4.453}], "id": "H.117. "}, {"ins_code": " ", "sesa": [{"sc": 54.7587, "total": 75.0606, "mc": 20.3019}], "name": "ASN", "chain": "H", "cv_coarse": [0.7092902359967379], "number": 118, "sap_score": [-0.8689427842245169], "cv_fine": [0.6861773463757075], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 78.219, "total": 88.587, "mc": 10.367}], "id": "H.118. "}, {"ins_code": " ", "sesa": [{"sc": 58.5958, "total": 58.977199999999996, "mc": 0.3814}], "name": "THR", "chain": "H", "cv_coarse": [0.5698276567562263], "number": 119, "sap_score": [-1.1857106074703245], "cv_fine": [0.6673310197030421], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 70.166, "total": 70.18, "mc": 0.014}], "id": "H.119. "}, {"ins_code": " ", "sesa": [{"sc": 40.3333, "total": 59.5213, "mc": 19.188}], "name": "ASP", "chain": "H", "cv_coarse": [0.4870160546693988], "number": 120, "sap_score": [-1.5607822345304527], "cv_fine": [0.561223614329124], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 49.508, "total": 67.879, "mc": 18.371}], "id": "H.120. "}, {"ins_code": " ", "sesa": [{"sc": 63.442600000000006, "total": 63.442600000000006, "mc": 0.0}], "name": "TYR", "chain": "H", "cv_coarse": [0.42053027885930105], "number": 121, "sap_score": [0.6123604881702643], "cv_fine": [0.6484703121757525], "name_short": "Y", "surface": [true], "secondary_structure": ["L"], "chemical_name": "TYROSINE", "fasa": [{"sc": 72.716, "total": 72.716, "mc": 0.0}], "id": "H.121. "}, {"ins_code": " ", "sesa": [{"sc": 48.0646, "total": 48.0646, "mc": 0.0}], "name": "PRO", "chain": "H", "cv_coarse": [0.3574968775818333], "number": 122, "sap_score": [0.1932227527292101], "cv_fine": [0.5624652098796631], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 67.549, "total": 67.549, "mc": 0.0}], "id": "H.122. "}, {"ins_code": " ", "sesa": [{"sc": 5.815, "total": 23.964100000000002, "mc": 18.1491}], "name": "GLY", "chain": "H", "cv_coarse": [0.31881159278841886], "number": 123, "sap_score": [1.3287808237149938], "cv_fine": [0.5200593299507474], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 5.236, "total": 22.306, "mc": 17.07}], "id": "H.123. "}, {"ins_code": " ", "sesa": [{"sc": 58.777899999999995, "total": 77.91199999999999, "mc": 19.1341}], "name": "PRO", "chain": "H", "cv_coarse": [0.2660267164582331], "number": 124, "sap_score": [1.1469226488928168], "cv_fine": [0.4149696595126726], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 85.438, "total": 112.397, "mc": 26.959}], "id": "H.124. "}, {"ins_code": " ", "sesa": [{"sc": 45.6741, "total": 45.6741, "mc": 0.0}], "name": "HIS", "chain": "H", "cv_coarse": [0.24594045302898207], "number": 125, "sap_score": [-0.2549023349785624], "cv_fine": [0.613594881308889], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 54.865, "total": 54.922, "mc": 0.058}], "id": "H.125. "}, {"ins_code": " ", "sesa": [{"sc": 47.098600000000005, "total": 51.361700000000006, "mc": 4.2631}], "name": "HIS", "chain": "H", "cv_coarse": [0.24994513336655566], "number": 126, "sap_score": [-0.981200440476564], "cv_fine": [0.6150157669113555], "name_short": "H", "surface": [true], "secondary_structure": ["L"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 52.386, "total": 54.137, "mc": 1.751}], "id": "H.126. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 9.3223, "mc": 9.3223}], "name": "PHE", "chain": "H", "cv_coarse": [0.3674682214309968], "number": 127, "sap_score": [-0.3549706967235621], "cv_fine": [0.8666567790315355], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 1.068, "total": 2.852, "mc": 1.785}], "id": "H.127. "}, {"ins_code": " ", "sesa": [{"sc": 49.489000000000004, "total": 49.489000000000004, "mc": 0.0}], "name": "GLU", "chain": "H", "cv_coarse": [0.2898797705933458], "number": 128, "sap_score": [-1.0599739320984112], "cv_fine": [0.6702144248227687], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 53.852, "total": 53.852, "mc": 0.0}], "id": "H.128. "}, {"ins_code": " ", "sesa": [{"sc": 12.2871, "total": 31.171799999999998, "mc": 18.8847}], "name": "VAL", "chain": "H", "cv_coarse": [0.3733188161967983], "number": 129, "sap_score": [0.3386342596708225], "cv_fine": [0.8478116920568078], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 4.159, "total": 19.672, "mc": 15.513}], "id": "H.129. "}, {"ins_code": " ", "sesa": [{"sc": 53.3856, "total": 55.6597, "mc": 2.2741}], "name": "THR", "chain": "H", "cv_coarse": [0.29252277396090226], "number": 130, "sap_score": [0.5371028678567901], "cv_fine": [0.6941128927661113], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 62.702, "total": 62.702, "mc": 0.0}], "id": "H.130. "}, {"ins_code": " ", "sesa": [{"sc": 34.6596, "total": 50.08310000000001, "mc": 15.4235}], "name": "PHE", "chain": "H", "cv_coarse": [0.31739053770283415], "number": 131, "sap_score": [0.23463438523627872], "cv_fine": [0.7953804526759884], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 19.222, "total": 33.607, "mc": 14.384}], "id": "H.131. "}, {"ins_code": " ", "sesa": [{"sc": 54.376999999999995, "total": 60.0458, "mc": 5.668799999999999}], "name": "GLN", "chain": "H", "cv_coarse": [0.21629059487728147], "number": 132, "sap_score": [-0.9448208471326056], "cv_fine": [0.6172909900944629], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 60.042, "total": 61.437, "mc": 1.395}], "id": "H.132. "}, {"ins_code": " ", "sesa": [{"sc": 83.27669999999999, "total": 103.0183, "mc": 19.7416}], "name": "GLN", "chain": "H", "cv_coarse": [0.1676575785961233], "number": 133, "sap_score": [-2.0702822223035886], "cv_fine": [0.4077555374677323], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 155.025, "total": 172.737, "mc": 17.712}], "id": "H.133. "}, {"ins_code": " ", "sesa": [{"sc": 25.3551, "total": 48.50450000000001, "mc": 23.1494}], "name": "SER", "chain": "H", "cv_coarse": [0.21119088770238117], "number": 134, "sap_score": [-1.4244872678759508], "cv_fine": [0.6626875455692213], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 14.639, "total": 34.222, "mc": 19.583}], "id": "H.134. "}, {"ins_code": " ", "sesa": [{"sc": 32.688500000000005, "total": 54.0026, "mc": 21.3141}], "name": "SER", "chain": "H", "cv_coarse": [0.1751547351738548], "number": 135, "sap_score": [-0.7296089223741418], "cv_fine": [0.5598446112158194], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 52.288, "total": 61.535, "mc": 9.247}], "id": "H.135. "}, {"ins_code": " ", "sesa": [{"sc": 61.1081, "total": 84.1246, "mc": 23.0165}], "name": "THR", "chain": "H", "cv_coarse": [0.16072153068623554], "number": 136, "sap_score": [-0.4222339731420025], "cv_fine": [0.42772153392040974], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 116.197, "total": 142.133, "mc": 25.936}], "id": "H.136. "}, {"ins_code": " ", "sesa": [{"sc": 33.6121, "total": 44.9298, "mc": 11.317699999999999}], "name": "ALA", "chain": "H", "cv_coarse": [0.15752142165959312], "number": 137, "sap_score": [-0.8063166012868397], "cv_fine": [0.4845729391027767], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 47.69, "total": 50.343, "mc": 2.653}], "id": "H.137. "}, {"ins_code": " ", "sesa": [{"sc": 88.2311, "total": 112.431, "mc": 24.1999}], "name": "LYS", "chain": "H", "cv_coarse": [0.1589706689791324], "number": 138, "sap_score": [-1.155628176425119], "cv_fine": [0.4323035158262707], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 130.827, "total": 150.81, "mc": 19.982}], "id": "H.138. "}, {"ins_code": " ", "sesa": [{"sc": 42.3157, "total": 63.7218, "mc": 21.406100000000002}], "name": "SER", "chain": "H", "cv_coarse": [0.15646276411247353], "number": 139, "sap_score": [-0.7515387180218723], "cv_fine": [0.4086166851891086], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 80.319, "total": 99.889, "mc": 19.57}], "id": "H.139. "}, {"ins_code": " ", "sesa": [{"sc": 21.371000000000002, "total": 32.864900000000006, "mc": 11.4939}], "name": "ALA", "chain": "H", "cv_coarse": [0.1991344595018024], "number": 140, "sap_score": [-0.5804762466026948], "cv_fine": [0.6296713531882563], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 11.427, "total": 13.695, "mc": 2.267}], "id": "H.140. "}, {"ins_code": " ", "sesa": [{"sc": 43.2211, "total": 50.1512, "mc": 6.9301}], "name": "THR", "chain": "H", "cv_coarse": [0.22574977347270173], "number": 141, "sap_score": [-0.1052709673952917], "cv_fine": [0.6336799271071177], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 51.966, "total": 55.378, "mc": 3.412}], "id": "H.141. "}, {"ins_code": " ", "sesa": [{"sc": 30.1711, "total": 38.7973, "mc": 8.6262}], "name": "TRP", "chain": "H", "cv_coarse": [0.27032959456004335], "number": 142, "sap_score": [0.3456479108417439], "cv_fine": [0.8102632854401018], "name_short": "W", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TRYPTOPHAN", "fasa": [{"sc": 26.262, "total": 27.838, "mc": 1.577}], "id": "H.142. "}, {"ins_code": " ", "sesa": [{"sc": 16.7312, "total": 16.7312, "mc": 0.0}], "name": "THR", "chain": "H", "cv_coarse": [0.2980067934311988], "number": 143, "sap_score": [-0.6447295191712992], "cv_fine": [0.8903002824763642], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 2.513, "total": 2.513, "mc": 0.0}], "id": "H.143. "}, {"ins_code": " ", "sesa": [{"sc": 35.157199999999996, "total": 44.7489, "mc": 9.5917}], "name": "TYR", "chain": "H", "cv_coarse": [0.3635982937647921], "number": 144, "sap_score": [0.4188447710105268], "cv_fine": [0.8108329537682731], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 14.909, "total": 19.358, "mc": 4.449}], "id": "H.144. "}, {"ins_code": " ", "sesa": [{"sc": 4.4752, "total": 4.4752, "mc": 0.0}], "name": "SER", "chain": "H", "cv_coarse": [0.34581648700828627], "number": 145, "sap_score": [1.5476392878703984], "cv_fine": [0.7265947164425374], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 0.255, "total": 0.255, "mc": 0.0}], "id": "H.145. "}, {"ins_code": " ", "sesa": [{"sc": 54.0563, "total": 67.705, "mc": 13.6487}], "name": "PRO", "chain": "H", "cv_coarse": [0.30441432017656617], "number": 146, "sap_score": [1.67597990118514], "cv_fine": [0.47048327784461297], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 80.339, "total": 97.212, "mc": 16.873}], "id": "H.146. "}, {"ins_code": " ", "sesa": [{"sc": 73.14500000000001, "total": 94.0349, "mc": 20.8899}], "name": "LEU", "chain": "H", "cv_coarse": [0.30995029909382993], "number": 147, "sap_score": [2.7877144722739966], "cv_fine": [0.4977447744011306], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 86.684, "total": 111.369, "mc": 24.686}], "id": "H.147. "}, {"ins_code": " ", "sesa": [{"sc": 41.9501, "total": 51.1346, "mc": 9.1845}], "name": "LEU", "chain": "H", "cv_coarse": [0.3940475251561063], "number": 148, "sap_score": [1.7285250839166035], "cv_fine": [0.6685806718040564], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 33.024, "total": 41.115, "mc": 8.091}], "id": "H.148. "}, {"ins_code": " ", "sesa": [{"sc": 68.3014, "total": 68.3014, "mc": 0.0}], "name": "LYS", "chain": "H", "cv_coarse": [0.4412114406918428], "number": 149, "sap_score": [-0.3457291757213702], "cv_fine": [0.6545136216538704], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 79.548, "total": 79.548, "mc": 0.0}], "id": "H.149. "}, {"ins_code": " ", "sesa": [{"sc": 47.0536, "total": 47.0536, "mc": 0.0}], "name": "LYS", "chain": "H", "cv_coarse": [0.47060492553505145], "number": 150, "sap_score": [-0.04238013735012737], "cv_fine": [0.78943726750824], "name_short": "K", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LYSINE", "fasa": [{"sc": 36.467, "total": 36.467, "mc": 0.0}], "id": "H.150. "}, {"ins_code": " ", "sesa": [{"sc": 12.3025, "total": 12.3025, "mc": 0.0}], "name": "TYR", "chain": "H", "cv_coarse": [0.3751613205247037], "number": 152, "sap_score": [-0.7522282482984209], "cv_fine": [0.9105276453945899], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 0.596, "total": 0.596, "mc": 0.0}], "id": "H.152. "}, {"ins_code": " ", "sesa": [{"sc": 45.453500000000005, "total": 45.453500000000005, "mc": 0.0}], "name": "GLN", "chain": "H", "cv_coarse": [0.2746990730825364], "number": 154, "sap_score": [-0.30854304756844464], "cv_fine": [0.6807261074306797], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 46.704, "total": 46.704, "mc": 0.0}], "id": "H.154. "}, {"ins_code": " ", "sesa": [{"sc": 51.94890000000001, "total": 65.637, "mc": 13.688099999999999}], "name": "ILE", "chain": "H", "cv_coarse": [0.2990985857058498], "number": 155, "sap_score": [0.7237365976665414], "cv_fine": [0.6986949121934694], "name_short": "I", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 42.604, "total": 52.772, "mc": 10.168}], "id": "H.155. "}, {"ins_code": " ", "sesa": [{"sc": 12.3923, "total": 30.878100000000003, "mc": 18.4858}], "name": "ALA", "chain": "H", "cv_coarse": [0.26746390073042764], "number": 156, "sap_score": [1.1119978066135159], "cv_fine": [0.6713944025968691], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 6.116, "total": 21.962, "mc": 15.846}], "id": "H.156. "}, {"ins_code": " ", "sesa": [{"sc": 66.13980000000001, "total": 66.13980000000001, "mc": 0.0}], "name": "LYS", "chain": "H", "cv_coarse": [0.23791887654852348], "number": 157, "sap_score": [-0.45457649687909485], "cv_fine": [0.5725269728739367], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 96.195, "total": 96.195, "mc": 0.0}], "id": "H.157. "}, {"ins_code": " ", "sesa": [{"sc": 33.431, "total": 49.8753, "mc": 16.444300000000002}], "name": "THR", "chain": "H", "cv_coarse": [0.25019032398255053], "number": 158, "sap_score": [-0.2785274901669182], "cv_fine": [0.6199185235480172], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 46.184, "total": 52.613, "mc": 6.429}], "id": "H.158. "}, {"ins_code": " ", "sesa": [{"sc": 26.337999999999997, "total": 26.337999999999997, "mc": 0.0}], "name": "PRO", "chain": "H", "cv_coarse": [0.28228564943465123], "number": 160, "sap_score": [0.4179383965483725], "cv_fine": [0.800871908822925], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 18.406, "total": 19.059, "mc": 0.653}], "id": "H.160. "}, {"ins_code": " ", "sesa": [{"sc": 26.6509, "total": 30.426900000000003, "mc": 3.776}], "name": "GLN", "chain": "H", "cv_coarse": [0.275695577540219], "number": 162, "sap_score": [0.5847873494032694], "cv_fine": [0.8671170131029017], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 4.106, "total": 4.115, "mc": 0.009}], "id": "H.162. "}, {"ins_code": " ", "sesa": [{"sc": 10.4669, "total": 12.356000000000002, "mc": 1.8891}], "name": "ILE", "chain": "H", "cv_coarse": [0.3148707881707082], "number": 163, "sap_score": [0.14204368379233256], "cv_fine": [0.9538698275838634], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 1.767, "total": 1.913, "mc": 0.147}], "id": "H.163. "}, {"ins_code": " ", "sesa": [{"sc": 67.8029, "total": 67.8029, "mc": 0.0}], "name": "LYS", "chain": "H", "cv_coarse": [0.2516014689667302], "number": 164, "sap_score": [-1.0151087611593625], "cv_fine": [0.728007981550701], "name_short": "K", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LYSINE", "fasa": [{"sc": 51.471, "total": 51.471, "mc": 0.0}], "id": "H.164. "}, {"ins_code": " ", "sesa": [{"sc": 9.729099999999999, "total": 39.9736, "mc": 30.244500000000002}], "name": "VAL", "chain": "H", "cv_coarse": [0.22524793181877253], "number": 165, "sap_score": [0.5164048519014258], "cv_fine": [0.7941099065228233], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 6.952, "total": 36.153, "mc": 29.202}], "id": "H.165. "}, {"ins_code": " ", "sesa": [{"sc": 40.3236, "total": 54.3911, "mc": 14.0675}], "name": "SER", "chain": "H", "cv_coarse": [0.17533629592396918], "number": 166, "sap_score": [-0.29377393574684324], "cv_fine": [0.4380479180112875], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 65.906, "total": 89.204, "mc": 23.299}], "id": "H.166. "}, {"ins_code": " ", "sesa": [{"sc": 46.4688, "total": 46.4688, "mc": 0.0}], "name": "THR", "chain": "H", "cv_coarse": [0.18591727595805876], "number": 167, "sap_score": [-0.2371633741216297], "cv_fine": [0.521828982038886], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 65.72, "total": 65.837, "mc": 0.117}], "id": "H.167. "}, {"ins_code": " ", "sesa": [{"sc": 40.4808, "total": 48.5892, "mc": 8.1084}], "name": "PRO", "chain": "H", "cv_coarse": [0.18335279747204772], "number": 168, "sap_score": [0.79679223385469], "cv_fine": [0.6387330577489344], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 48.12, "total": 52.835, "mc": 4.714}], "id": "H.168. "}, {"ins_code": " ", "sesa": [{"sc": 55.864, "total": 68.73349999999999, "mc": 12.8695}], "name": "PRO", "chain": "H", "cv_coarse": [0.1685939736542619], "number": 169, "sap_score": [1.0798337579260022], "cv_fine": [0.4687227751184017], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 84.628, "total": 99.389, "mc": 14.761}], "id": "H.169. "}, {"ins_code": " ", "sesa": [{"sc": 20.326900000000002, "total": 31.996000000000002, "mc": 11.6691}], "name": "PRO", "chain": "H", "cv_coarse": [0.20998379452203178], "number": 170, "sap_score": [0.9742002780753498], "cv_fine": [0.6444166499860818], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 17.469, "total": 26.715, "mc": 9.247}], "id": "H.170. "}, {"ins_code": " ", "sesa": [{"sc": 43.353899999999996, "total": 44.23480000000001, "mc": 0.8809}], "name": "PRO", "chain": "H", "cv_coarse": [0.1929482609984307], "number": 171, "sap_score": [0.45760630709287126], "cv_fine": [0.4811539441558277], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 59.706, "total": 59.787, "mc": 0.081}], "id": "H.171. "}, {"ins_code": " ", "sesa": [{"sc": 17.8045, "total": 46.948800000000006, "mc": 29.1443}], "name": "GLY", "chain": "H", "cv_coarse": [0.2198068795361343], "number": 172, "sap_score": [-0.667424103715535], "cv_fine": [0.5326829115159235], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 28.73, "total": 57.401, "mc": 28.671}], "id": "H.172. "}, {"ins_code": " ", "sesa": [{"sc": 5.3591, "total": 13.084499999999998, "mc": 7.7254}], "name": "THR", "chain": "H", "cv_coarse": [0.26620089271223957], "number": 173, "sap_score": [0.38796281410982253], "cv_fine": [0.807508030586669], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 2.31, "total": 3.811, "mc": 1.502}], "id": "H.173. "}, {"ins_code": " ", "sesa": [{"sc": 24.3759, "total": 28.6476, "mc": 4.2717}], "name": "ALA", "chain": "H", "cv_coarse": [0.335749962202169], "number": 174, "sap_score": [0.09579863156785122], "cv_fine": [0.8815602806834061], "name_short": "A", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ALANINE", "fasa": [{"sc": 19.366, "total": 19.595, "mc": 0.229}], "id": "H.174. "}, {"ins_code": " ", "sesa": [{"sc": 14.1217, "total": 14.1217, "mc": 0.0}], "name": "ILE", "chain": "H", "cv_coarse": [0.38242225966195664], "number": 175, "sap_score": [0.10315103811309956], "cv_fine": [0.9348919659586378], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 4.23, "total": 4.87, "mc": 0.64}], "id": "H.175. "}, {"ins_code": " ", "sesa": [{"sc": 55.22, "total": 55.22, "mc": 0.0}], "name": "ARG", "chain": "H", "cv_coarse": [0.48400532920681144], "number": 176, "sap_score": [-0.7229523642305599], "cv_fine": [0.8475236565402114], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 38.586, "total": 38.586, "mc": 0.0}], "id": "H.176. "}, {"ins_code": " ", "sesa": [{"sc": 31.805799999999998, "total": 31.805799999999998, "mc": 0.0}], "name": "MET", "chain": "H", "cv_coarse": [0.6459382497004108], "number": 178, "sap_score": [-0.14895121246600043], "cv_fine": [0.9093538257342801], "name_short": "M", "surface": [true], "secondary_structure": ["S"], "chemical_name": "METHIONINE", "fasa": [{"sc": 21.86, "total": 21.86, "mc": 0.0}], "id": "H.178. "}, {"ins_code": " ", "sesa": [{"sc": 21.4678, "total": 21.4678, "mc": 0.0}], "name": "VAL", "chain": "H", "cv_coarse": [0.7989855022378665], "number": 180, "sap_score": [0.1327213738794365], "cv_fine": [0.9129423878587352], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 6.371, "total": 6.371, "mc": 0.0}], "id": "H.180. "}, {"ins_code": " ", "sesa": [{"sc": 22.099600000000002, "total": 28.3896, "mc": 6.29}], "name": "TYR", "chain": "H", "cv_coarse": [0.7348247487579567], "number": 181, "sap_score": [-0.020751785052902146], "cv_fine": [0.8852964343168651], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 5.0, "total": 6.624, "mc": 1.624}], "id": "H.181. "}, {"ins_code": " ", "sesa": [{"sc": 56.4415, "total": 75.51440000000001, "mc": 19.0729}], "name": "LYS", "chain": "H", "cv_coarse": [0.7200373561984742], "number": 182, "sap_score": [-0.7162609161864246], "cv_fine": [0.6228518644024947], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 59.575, "total": 85.709, "mc": 26.134}], "id": "H.182. "}, {"ins_code": " ", "sesa": [{"sc": 97.1542, "total": 104.5745, "mc": 7.4203}], "name": "LYS", "chain": "H", "cv_coarse": [0.71040236246888], "number": 183, "sap_score": [-0.8575983314883436], "cv_fine": [0.6734648039602571], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 128.89, "total": 129.06, "mc": 0.17}], "id": "H.183. "}, {"ins_code": " ", "sesa": [{"sc": 32.2843, "total": 42.5186, "mc": 10.2343}], "name": "ALA", "chain": "H", "cv_coarse": [0.823531720636207], "number": 184, "sap_score": [-0.29741458427894296], "cv_fine": [0.8157020891028273], "name_short": "A", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ALANINE", "fasa": [{"sc": 24.126, "total": 28.438, "mc": 4.311}], "id": "H.184. "}, {"ins_code": " ", "sesa": [{"sc": 40.5621, "total": 55.7643, "mc": 15.2022}], "name": "GLU", "chain": "H", "cv_coarse": [0.7111253121682196], "number": 185, "sap_score": [-0.8442600099283707], "cv_fine": [0.7940906875353151], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 17.6, "total": 24.693, "mc": 7.093}], "id": "H.185. "}, {"ins_code": " ", "sesa": [{"sc": 54.079699999999995, "total": 56.195, "mc": 2.1153}], "name": "HIS", "chain": "H", "cv_coarse": [0.6826489662436649], "number": 186, "sap_score": [-1.264780165048016], "cv_fine": [0.7502691622919908], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 55.823, "total": 55.825, "mc": 0.002}], "id": "H.186. "}, {"ins_code": " ", "sesa": [{"sc": 45.1537, "total": 48.6332, "mc": 3.4795000000000003}], "name": "VAL", "chain": "H", "cv_coarse": [0.8653390332494239], "number": 187, "sap_score": [-0.011996863478455536], "cv_fine": [0.8820391177085128], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 21.762, "total": 22.251, "mc": 0.489}], "id": "H.187. "}, {"ins_code": " ", "sesa": [{"sc": 34.794399999999996, "total": 54.202999999999996, "mc": 19.4086}], "name": "THR", "chain": "H", "cv_coarse": [0.7319017761735587], "number": 188, "sap_score": [-0.9886036327120461], "cv_fine": [0.7275780087319131], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 23.516, "total": 47.641, "mc": 24.125}], "id": "H.188. "}, {"ins_code": " ", "sesa": [{"sc": 52.407399999999996, "total": 55.4075, "mc": 3.0001}], "name": "ASP", "chain": "H", "cv_coarse": [0.6474340599614024], "number": 189, "sap_score": [-1.0985197396675728], "cv_fine": [0.6264823125226084], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 69.141, "total": 69.209, "mc": 0.068}], "id": "H.189. "}, {"ins_code": " ", "sesa": [{"sc": 51.0301, "total": 68.10900000000001, "mc": 17.0789}], "name": "VAL", "chain": "H", "cv_coarse": [0.5905071821428345], "number": 190, "sap_score": [0.6173808556809429], "cv_fine": [0.6373592153115333], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 59.483, "total": 71.471, "mc": 11.988}], "id": "H.190. "}, {"ins_code": " ", "sesa": [{"sc": 44.7826, "total": 55.4357, "mc": 10.6531}], "name": "LYS", "chain": "H", "cv_coarse": [0.4961243024091522], "number": 192, "sap_score": [-0.2649739394518115], "cv_fine": [0.7626413770938251], "name_short": "K", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LYSINE", "fasa": [{"sc": 39.134, "total": 41.892, "mc": 2.758}], "id": "H.192. "}, {"ins_code": " ", "sesa": [{"sc": 15.5016, "total": 30.4955, "mc": 14.9939}], "name": "ARG", "chain": "H", "cv_coarse": [0.37752214700352815], "number": 193, "sap_score": [-0.37813765847173836], "cv_fine": [0.8824896345028695], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 5.302, "total": 14.351, "mc": 9.049}], "id": "H.193. "}, {"ins_code": " ", "sesa": [{"sc": 14.504199999999999, "total": 14.504199999999999, "mc": 0.0}], "name": "CYS", "chain": "H", "cv_coarse": [0.37792371180474005], "number": 194, "sap_score": [0.09125774947450535], "cv_fine": [0.7607605648051637], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 3.032, "total": 3.396, "mc": 0.364}], "id": "H.194. "}, {"ins_code": " ", "sesa": [{"sc": 55.7568, "total": 61.4071, "mc": 5.6503}], "name": "PRO", "chain": "H", "cv_coarse": [0.3197323254695191], "number": 195, "sap_score": [-0.05339175452616644], "cv_fine": [0.4864802210777461], "name_short": "P", "surface": [true], "secondary_structure": ["H"], "chemical_name": "PROLINE", "fasa": [{"sc": 29.215, "total": 29.353, "mc": 0.139}], "id": "H.195. "}, {"ins_code": " ", "sesa": [{"sc": 69.1689, "total": 86.7761, "mc": 17.6072}], "name": "ASN", "chain": "H", "cv_coarse": [0.2542011752282925], "number": 196, "sap_score": [0.4361618671268881], "cv_fine": [0.44914936064047706], "name_short": "N", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 6.71, "total": 9.235, "mc": 2.526}], "id": "H.196. "}, {"ins_code": " ", "sesa": [{"sc": 59.4227, "total": 62.9681, "mc": 3.5454}], "name": "HIS", "chain": "H", "cv_coarse": [0.28610834718520406], "number": 197, "sap_score": [-0.4197337720882731], "cv_fine": [0.700070708977474], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 53.156, "total": 53.621, "mc": 0.465}], "id": "H.197. "}, {"ins_code": " ", "sesa": [{"sc": 28.4954, "total": 31.7018, "mc": 3.2064}], "name": "GLU", "chain": "H", "cv_coarse": [0.3044929879479076], "number": 198, "sap_score": [0.43050955551266445], "cv_fine": [0.6519842095559786], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 25.785, "total": 26.29, "mc": 0.505}], "id": "H.198. "}, {"ins_code": " ", "sesa": [{"sc": 68.47200000000001, "total": 83.67680000000001, "mc": 15.2048}], "name": "LEU", "chain": "H", "cv_coarse": [0.23993788887709133], "number": 199, "sap_score": [0.6262463066520282], "cv_fine": [0.43670137311247587], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 75.749, "total": 98.521, "mc": 22.772}], "id": "H.199. "}, {"ins_code": " ", "sesa": [{"sc": 18.081, "total": 28.2296, "mc": 10.1486}], "name": "GLY", "chain": "H", "cv_coarse": [0.21306552011112934], "number": 200, "sap_score": [-1.9419480327182992], "cv_fine": [0.6232134691501476], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 15.813, "total": 18.396, "mc": 2.583}], "id": "H.200. "}, {"ins_code": " ", "sesa": [{"sc": 114.97649999999999, "total": 127.33059999999999, "mc": 12.3541}], "name": "ARG", "chain": "H", "cv_coarse": [0.1521087593593831], "number": 201, "sap_score": [-4.305182277540817], "cv_fine": [0.37900973774605046], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 186.926, "total": 194.402, "mc": 7.476}], "id": "H.201. "}, {"ins_code": " ", "sesa": [{"sc": 65.94969999999999, "total": 83.78150000000001, "mc": 17.8318}], "name": "ASP", "chain": "H", "cv_coarse": [0.18361844307505393], "number": 202, "sap_score": [-2.7701957792635246], "cv_fine": [0.46132711836333357], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 95.748, "total": 112.423, "mc": 16.676}], "id": "H.202. "}, {"ins_code": " ", "sesa": [{"sc": 73.2449, "total": 81.9035, "mc": 8.6586}], "name": "PHE", "chain": "H", "cv_coarse": [0.2216865285041181], "number": 203, "sap_score": [0.6119811008369693], "cv_fine": [0.6651660987827139], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 83.847, "total": 84.895, "mc": 1.048}], "id": "H.203. "}, {"ins_code": " ", "sesa": [{"sc": 40.7704, "total": 56.6912, "mc": 15.9208}], "name": "ASN", "chain": "H", "cv_coarse": [0.2190060948862117], "number": 204, "sap_score": [-1.5532835434072305], "cv_fine": [0.6806905455670975], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 26.456, "total": 44.316, "mc": 17.86}], "id": "H.204. "}, {"ins_code": " ", "sesa": [{"sc": 78.86359999999999, "total": 98.7296, "mc": 19.866}], "name": "GLU", "chain": "H", "cv_coarse": [0.1532189975125459], "number": 205, "sap_score": [-3.0183792864294294], "cv_fine": [0.40042614968348383], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 120.626, "total": 147.62, "mc": 26.994}], "id": "H.205. "}, {"ins_code": " ", "sesa": [{"sc": 19.0736, "total": 42.3109, "mc": 23.237299999999998}], "name": "GLY", "chain": "H", "cv_coarse": [0.17331796339226335], "number": 206, "sap_score": [-2.5922257200352647], "cv_fine": [0.4292450406263532], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 30.09, "total": 66.527, "mc": 36.437}], "id": "H.206. "}, {"ins_code": " ", "sesa": [{"sc": 51.5765, "total": 70.1472, "mc": 18.570700000000002}], "name": "GLN", "chain": "H", "cv_coarse": [0.22319730168720545], "number": 207, "sap_score": [-1.3719512578175213], "cv_fine": [0.6222412220589504], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 46.527, "total": 63.243, "mc": 16.716}], "id": "H.207. "}, {"ins_code": " ", "sesa": [{"sc": 45.2318, "total": 67.8339, "mc": 22.6021}], "name": "SER", "chain": "H", "cv_coarse": [0.22390705406108466], "number": 208, "sap_score": [-1.0940341191610092], "cv_fine": [0.47538283869427467], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 89.927, "total": 112.246, "mc": 22.319}], "id": "H.208. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 15.3885, "mc": 15.3885}], "name": "ALA", "chain": "H", "cv_coarse": [0.2804555341782754], "number": 209, "sap_score": [-0.7149110976695375], "cv_fine": [0.68262744077736], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 0.0, "total": 8.362, "mc": 8.362}], "id": "H.209. "}, {"ins_code": " ", "sesa": [{"sc": 34.5968, "total": 34.5968, "mc": 0.0}], "name": "PRO", "chain": "H", "cv_coarse": [0.32269862708012803], "number": 210, "sap_score": [0.33414689893107674], "cv_fine": [0.6365179181883225], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 34.248, "total": 34.248, "mc": 0.0}], "id": "H.210. "}, {"ins_code": " ", "sesa": [{"sc": 32.8225, "total": 42.0633, "mc": 9.2408}], "name": "ALA", "chain": "H", "cv_coarse": [0.31124240062662495], "number": 211, "sap_score": [0.2454863920252303], "cv_fine": [0.6601361720227813], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 36.167, "total": 44.653, "mc": 8.486}], "id": "H.211. "}, {"ins_code": " ", "sesa": [{"sc": 33.3251, "total": 38.5704, "mc": 5.2453}], "name": "SER", "chain": "H", "cv_coarse": [0.3843220781535614], "number": 212, "sap_score": [-0.09273025784280711], "cv_fine": [0.6514810630785016], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 38.445, "total": 40.173, "mc": 1.727}], "id": "H.212. "}, {"ins_code": " ", "sesa": [{"sc": 29.249000000000002, "total": 29.249000000000002, "mc": 0.0}], "name": "ARG", "chain": "H", "cv_coarse": [0.33977565333531545], "number": 216, "sap_score": [-0.24422870673331168], "cv_fine": [0.9129618484219286], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 7.571, "total": 7.571, "mc": 0.0}], "id": "H.216. "}, {"ins_code": " ", "sesa": [{"sc": 8.6396, "total": 25.723, "mc": 17.0834}], "name": "VAL", "chain": "H", "cv_coarse": [0.314017048643733], "number": 217, "sap_score": [-0.3857288441671412], "cv_fine": [0.8616646963876774], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 1.9, "total": 12.047, "mc": 10.147}], "id": "H.217. "}, {"ins_code": " ", "sesa": [{"sc": 52.740700000000004, "total": 71.8639, "mc": 19.1232}], "name": "GLU", "chain": "H", "cv_coarse": [0.22972532950142843], "number": 218, "sap_score": [-1.2798008246184804], "cv_fine": [0.5512355814232], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 71.132, "total": 99.121, "mc": 27.99}], "id": "H.218. "}, {"ins_code": " ", "sesa": [{"sc": 19.1313, "total": 45.181000000000004, "mc": 26.0497}], "name": "GLY", "chain": "H", "cv_coarse": [0.20194373306319985], "number": 219, "sap_score": [-0.7700635980558549], "cv_fine": [0.5048330057511602], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 25.543, "total": 65.043, "mc": 39.5}], "id": "H.219. "}, {"ins_code": " ", "sesa": [{"sc": 34.141400000000004, "total": 49.17229999999999, "mc": 15.0309}], "name": "ASN", "chain": "H", "cv_coarse": [0.2250657871946855], "number": 220, "sap_score": [-0.727668895073589], "cv_fine": [0.6335998199123998], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 28.095, "total": 38.17, "mc": 10.076}], "id": "H.220. "}, {"ins_code": " ", "sesa": [{"sc": 66.3671, "total": 87.429, "mc": 21.0619}], "name": "ASN", "chain": "H", "cv_coarse": [0.17916385831500098], "number": 221, "sap_score": [-0.8266050732486245], "cv_fine": [0.3800942603187244], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 127.807, "total": 143.985, "mc": 16.177}], "id": "H.221. "}, {"ins_code": " ", "sesa": [{"sc": 75.2989, "total": 79.3029, "mc": 4.004}], "name": "LEU", "chain": "H", "cv_coarse": [0.20298004345439052], "number": 222, "sap_score": [1.5809241356425094], "cv_fine": [0.4755118210177902], "name_short": "L", "surface": [true], "secondary_structure": ["L"], "chemical_name": "LEUCINE", "fasa": [{"sc": 115.787, "total": 116.802, "mc": 1.015}], "id": "H.222. "}, {"ins_code": " ", "sesa": [{"sc": 13.9101, "total": 29.2592, "mc": 15.3491}], "name": "SER", "chain": "H", "cv_coarse": [0.2663128608449368], "number": 223, "sap_score": [0.2698824791693877], "cv_fine": [0.7142720502854495], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 7.922, "total": 26.331, "mc": 18.409}], "id": "H.223. "}, {"ins_code": " ", "sesa": [{"sc": 58.191, "total": 58.191, "mc": 0.0}], "name": "GLN", "chain": "H", "cv_coarse": [0.29530541584379333], "number": 224, "sap_score": [-0.36577269849569033], "cv_fine": [0.5872202763510276], "name_short": "Q", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 79.686, "total": 79.686, "mc": 0.0}], "id": "H.224. "}, {"ins_code": " ", "sesa": [{"sc": 41.078199999999995, "total": 67.6623, "mc": 26.5841}], "name": "TYR", "chain": "H", "cv_coarse": [0.33070288683685395], "number": 225, "sap_score": [0.6713776845713347], "cv_fine": [0.7354319936792693], "name_short": "Y", "surface": [true], "secondary_structure": ["S"], "chemical_name": "TYROSINE", "fasa": [{"sc": 27.886, "total": 57.148, "mc": 29.262}], "id": "H.225. "}, {"ins_code": " ", "sesa": [{"sc": 50.465599999999995, "total": 50.465599999999995, "mc": 0.0}], "name": "VAL", "chain": "H", "cv_coarse": [0.40435698548738913], "number": 226, "sap_score": [0.18544855595328746], "cv_fine": [0.6633366512022433], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 50.997, "total": 50.997, "mc": 0.0}], "id": "H.226. "}, {"ins_code": " ", "sesa": [{"sc": 47.5227, "total": 65.78269999999999, "mc": 18.26}], "name": "ASP", "chain": "H", "cv_coarse": [0.3945367714857169], "number": 227, "sap_score": [-0.9371564687197187], "cv_fine": [0.604976128781287], "name_short": "D", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 52.984, "total": 68.335, "mc": 15.351}], "id": "H.227. "}, {"ins_code": " ", "sesa": [{"sc": 31.109699999999997, "total": 39.7386, "mc": 8.6289}], "name": "ASP", "chain": "H", "cv_coarse": [0.43920654214626953], "number": 228, "sap_score": [-0.07906075859114278], "cv_fine": [0.6217714796927774], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 33.521, "total": 38.819, "mc": 5.298}], "id": "H.228. "}, {"ins_code": " ", "sesa": [{"sc": 61.112500000000004, "total": 79.19630000000001, "mc": 18.0838}], "name": "PRO", "chain": "H", "cv_coarse": [0.3631368698152541], "number": 229, "sap_score": [1.506946542611752], "cv_fine": [0.33592597566951854], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 101.009, "total": 131.631, "mc": 30.621}], "id": "H.229. "}, {"ins_code": " ", "sesa": [{"sc": 61.9693, "total": 79.7448, "mc": 17.7755}], "name": "VAL", "chain": "H", "cv_coarse": [0.41606735315593035], "number": 230, "sap_score": [1.7904581969139586], "cv_fine": [0.46299584387661913], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 103.513, "total": 134.835, "mc": 31.322}], "id": "H.230. "}, {"ins_code": " ", "sesa": [{"sc": 38.9337, "total": 55.8202, "mc": 16.8865}], "name": "THR", "chain": "H", "cv_coarse": [0.5304343212335242], "number": 231, "sap_score": [0.5993717838940179], "cv_fine": [0.7282541893825334], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 23.258, "total": 39.765, "mc": 16.507}], "id": "H.231. "}, {"ins_code": " ", "sesa": [{"sc": 17.5942, "total": 33.2582, "mc": 15.664}], "name": "GLY", "chain": "H", "cv_coarse": [0.5077623467855162], "number": 232, "sap_score": [-0.05569114234429066], "cv_fine": [0.6748887329272938], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 20.815, "total": 27.688, "mc": 6.873}], "id": "H.232. "}, {"ins_code": " ", "sesa": [{"sc": 46.5257, "total": 57.3866, "mc": 10.8609}], "name": "ARG", "chain": "H", "cv_coarse": [0.6451367077939503], "number": 233, "sap_score": [-0.46017880196233385], "cv_fine": [0.8615711643411911], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 22.256, "total": 23.673, "mc": 1.417}], "id": "H.233. "}, {"ins_code": " ", "sesa": [{"sc": 3.8273, "total": 3.8273, "mc": 0.0}], "name": "SER", "chain": "H", "cv_coarse": [0.5014284410623973], "number": 235, "sap_score": [-0.0817548973967692], "cv_fine": [0.8625404832950121], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 0.17, "total": 0.17, "mc": 0.0}], "id": "H.235. "}, {"ins_code": " ", "sesa": [{"sc": 21.503500000000003, "total": 21.503500000000003, "mc": 0.0}], "name": "VAL", "chain": "H", "cv_coarse": [0.37538047702743055], "number": 237, "sap_score": [-0.3860583953676977], "cv_fine": [0.8256229059144208], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 13.798, "total": 13.798, "mc": 0.0}], "id": "H.237. "}, {"ins_code": " ", "sesa": [{"sc": 15.4659, "total": 15.4659, "mc": 0.0}], "name": "VAL", "chain": "H", "cv_coarse": [0.3126068224675693], "number": 238, "sap_score": [0.11303520434169696], "cv_fine": [0.8773251778126944], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 7.231, "total": 7.368, "mc": 0.136}], "id": "H.238. "}, {"ins_code": " ", "sesa": [{"sc": 42.1387, "total": 52.756699999999995, "mc": 10.618}], "name": "PRO", "chain": "H", "cv_coarse": [0.2532698245388281], "number": 239, "sap_score": [0.8458550026376411], "cv_fine": [0.7344657229681439], "name_short": "P", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PROLINE", "fasa": [{"sc": 33.111, "total": 35.986, "mc": 2.875}], "id": "H.239. "}, {"ins_code": " ", "sesa": [{"sc": 45.8432, "total": 64.61649999999999, "mc": 18.7733}], "name": "TYR", "chain": "H", "cv_coarse": [0.23673363176640475], "number": 240, "sap_score": [0.40347281148188363], "cv_fine": [0.8211471518062794], "name_short": "Y", "surface": [true], "secondary_structure": ["L"], "chemical_name": "TYROSINE", "fasa": [{"sc": 17.326, "total": 38.229, "mc": 20.903}], "id": "H.240. "}, {"ins_code": " ", "sesa": [{"sc": 73.0243, "total": 79.6717, "mc": 6.6474}], "name": "GLU", "chain": "H", "cv_coarse": [0.1898232357674352], "number": 241, "sap_score": [-1.3430837857284659], "cv_fine": [0.6550184941221009], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 117.158, "total": 119.528, "mc": 2.369}], "id": "H.241. "}, {"ins_code": " ", "sesa": [{"sc": 50.7715, "total": 61.780199999999994, "mc": 11.0087}], "name": "PRO", "chain": "H", "cv_coarse": [0.16751930213930372], "number": 242, "sap_score": [-0.00433879984632593], "cv_fine": [0.6361134873655685], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 74.137, "total": 77.494, "mc": 3.358}], "id": "H.242. "}, {"ins_code": " ", "sesa": [{"sc": 51.0731, "total": 66.4082, "mc": 15.335099999999999}], "name": "PRO", "chain": "H", "cv_coarse": [0.1570876440817177], "number": 243, "sap_score": [-0.13673504339439926], "cv_fine": [0.7054240120134808], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 38.423, "total": 52.123, "mc": 13.7}], "id": "H.243. "}, {"ins_code": " ", "sesa": [{"sc": 84.0925, "total": 99.03540000000001, "mc": 14.9429}], "name": "GLN", "chain": "H", "cv_coarse": [0.12165899523806512], "number": 244, "sap_score": [-0.6202362073121002], "cv_fine": [0.43542240394637677], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 148.398, "total": 159.3, "mc": 10.902}], "id": "H.244. "}, {"ins_code": " ", "sesa": [{"sc": 67.7396, "total": 87.6291, "mc": 19.889499999999998}], "name": "VAL", "chain": "H", "cv_coarse": [0.09660639140375082], "number": 245, "sap_score": [1.1096439391461996], "cv_fine": [0.33080310878987923], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 122.064, "total": 141.696, "mc": 19.631}], "id": "H.245. "}, {"ins_code": " ", "sesa": [{"sc": 20.1665, "total": 46.7777, "mc": 26.611200000000004}], "name": "GLY", "chain": "H", "cv_coarse": [0.10444213313534298], "number": 246, "sap_score": [0.6025732004887849], "cv_fine": [0.33950043071711233], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 36.311, "total": 76.472, "mc": 40.161}], "id": "H.246. "}, {"ins_code": " ", "sesa": [{"sc": 56.1195, "total": 72.9757, "mc": 16.8562}], "name": "THR", "chain": "H", "cv_coarse": [0.12969829497030647], "number": 247, "sap_score": [-1.4756208910722715], "cv_fine": [0.46808888799278364], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 87.525, "total": 93.115, "mc": 5.59}], "id": "H.247. "}, {"ins_code": " ", "sesa": [{"sc": 73.053, "total": 89.2439, "mc": 16.1909}], "name": "GLU", "chain": "H", "cv_coarse": [0.17355085654627322], "number": 248, "sap_score": [-2.1609630291790354], "cv_fine": [0.5375608768907898], "name_short": "E", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 96.109, "total": 101.747, "mc": 5.638}], "id": "H.248. "}, {"ins_code": " ", "sesa": [{"sc": 86.9061, "total": 89.21289999999999, "mc": 2.3068}], "name": "PHE", "chain": "H", "cv_coarse": [0.1842791772648063], "number": 249, "sap_score": [0.7453410812061292], "cv_fine": [0.6462720975792304], "name_short": "F", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 89.189, "total": 89.552, "mc": 0.363}], "id": "H.249. "}, {"ins_code": " ", "sesa": [{"sc": 46.1475, "total": 46.1475, "mc": 0.0}], "name": "THR", "chain": "H", "cv_coarse": [0.22999943427608477], "number": 250, "sap_score": [0.017797627881630897], "cv_fine": [0.855001397827197], "name_short": "T", "surface": [true], "secondary_structure": ["L"], "chemical_name": "THREONINE", "fasa": [{"sc": 19.499, "total": 19.499, "mc": 0.0}], "id": "H.250. "}, {"ins_code": " ", "sesa": [{"sc": 40.3673, "total": 62.02340000000001, "mc": 21.656100000000002}], "name": "THR", "chain": "H", "cv_coarse": [0.22949204924210917], "number": 251, "sap_score": [0.11223166681866084], "cv_fine": [0.7157429284738355], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 51.02, "total": 73.386, "mc": 22.366}], "id": "H.251. "}, {"ins_code": " ", "sesa": [{"sc": 23.2777, "total": 23.2777, "mc": 0.0}], "name": "ILE", "chain": "H", "cv_coarse": [0.3178376701229141], "number": 252, "sap_score": [0.5093290013311179], "cv_fine": [0.9112005362134097], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 11.486, "total": 11.486, "mc": 0.0}], "id": "H.252. "}, {"ins_code": " ", "sesa": [{"sc": 50.4013, "total": 55.952600000000004, "mc": 5.5513}], "name": "LEU", "chain": "H", "cv_coarse": [0.2639586251916874], "number": 253, "sap_score": [1.032248487825318], "cv_fine": [0.6837965778294691], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 59.909, "total": 61.521, "mc": 1.612}], "id": "H.253. "}, {"ins_code": " ", "sesa": [{"sc": 15.5276, "total": 15.5276, "mc": 0.0}], "name": "ASN", "chain": "H", "cv_coarse": [0.3298596042279876], "number": 255, "sap_score": [-1.2480233425771117], "cv_fine": [0.8528341250228042], "name_short": "N", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 8.602, "total": 8.602, "mc": 0.0}], "id": "H.255. "}, {"ins_code": " ", "sesa": [{"sc": 14.763100000000001, "total": 18.5268, "mc": 3.7637}], "name": "MET", "chain": "H", "cv_coarse": [0.35422640813084433], "number": 257, "sap_score": [-0.0184982841356172], "cv_fine": [0.9006527099048467], "name_short": "M", "surface": [true], "secondary_structure": ["L"], "chemical_name": "METHIONINE", "fasa": [{"sc": 3.599, "total": 3.602, "mc": 0.003}], "id": "H.257. "}, {"ins_code": " ", "sesa": [{"sc": 30.747, "total": 30.747, "mc": 0.0}], "name": "ASN", "chain": "H", "cv_coarse": [0.3824656934426941], "number": 259, "sap_score": [0.07980303328610977], "cv_fine": [0.7619568442035659], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 26.121, "total": 26.141, "mc": 0.02}], "id": "H.259. "}, {"ins_code": " ", "sesa": [{"sc": 16.0979, "total": 16.0979, "mc": 0.0}], "name": "SER", "chain": "H", "cv_coarse": [0.47188954326566207], "number": 260, "sap_score": [-0.4071276000736889], "cv_fine": [0.8801311214058432], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 2.831, "total": 2.831, "mc": 0.0}], "id": "H.260. "}, {"ins_code": " ", "sesa": [{"sc": 36.0171, "total": 53.1046, "mc": 17.0875}], "name": "SER", "chain": "H", "cv_coarse": [0.38875046515511924], "number": 261, "sap_score": [-0.7161879063955363], "cv_fine": [0.6208964092037131], "name_short": "S", "surface": [true], "secondary_structure": ["L"], "chemical_name": "SERINE", "fasa": [{"sc": 38.581, "total": 49.615, "mc": 11.034}], "id": "H.261. "}, {"ins_code": " ", "sesa": [{"sc": 21.5705, "total": 22.6909, "mc": 1.1204}], "name": "CYS", "chain": "H", "cv_coarse": [0.38585138564114435], "number": 262, "sap_score": [0.15181549230578678], "cv_fine": [0.7013313725176985], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 16.405, "total": 16.409, "mc": 0.004}], "id": "H.262. "}, {"ins_code": " ", "sesa": [{"sc": 68.407, "total": 82.95689999999999, "mc": 14.549900000000001}], "name": "VAL", "chain": "H", "cv_coarse": [0.34081590819471674], "number": 263, "sap_score": [1.0325146441441297], "cv_fine": [0.4635367098857424], "name_short": "V", "surface": [true], "secondary_structure": ["L"], "chemical_name": "VALINE", "fasa": [{"sc": 93.404, "total": 94.521, "mc": 1.117}], "id": "H.263. "}, {"ins_code": " ", "sesa": [{"sc": 13.875, "total": 34.445499999999996, "mc": 20.570500000000003}], "name": "GLY", "chain": "H", "cv_coarse": [0.4181739510374755], "number": 264, "sap_score": [0.38705374355106814], "cv_fine": [0.5537679282957604], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 15.393, "total": 45.257, "mc": 29.864}], "id": "H.264. "}, {"ins_code": " ", "sesa": [{"sc": 7.9788, "total": 14.8446, "mc": 6.8658}], "name": "GLY", "chain": "H", "cv_coarse": [0.49181406756650375], "number": 265, "sap_score": [-0.3894757822215323], "cv_fine": [0.7629207717584299], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 3.105, "total": 6.468, "mc": 3.363}], "id": "H.265. "}, {"ins_code": " ", "sesa": [{"sc": 35.6802, "total": 47.30500000000001, "mc": 11.6248}], "name": "ASN", "chain": "H", "cv_coarse": [0.45005484325879397], "number": 267, "sap_score": [-1.3697019880888603], "cv_fine": [0.5861446305034794], "name_short": "N", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARAGINE", "fasa": [{"sc": 39.683, "total": 47.557, "mc": 7.875}], "id": "H.267. "}, {"ins_code": " ", "sesa": [{"sc": 98.0226, "total": 119.9648, "mc": 21.9422}], "name": "ARG", "chain": "H", "cv_coarse": [0.41919205496292733], "number": 268, "sap_score": [-3.081427809965059], "cv_fine": [0.39890564448645666], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 164.47, "total": 184.354, "mc": 19.883}], "id": "H.268. "}, {"ins_code": " ", "sesa": [{"sc": 67.057, "total": 67.057, "mc": 0.0}], "name": "ARG", "chain": "H", "cv_coarse": [0.5715980681386198], "number": 269, "sap_score": [-1.2841236546232462], "cv_fine": [0.6970603825258539], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 52.673, "total": 52.673, "mc": 0.0}], "id": "H.269. "}, {"ins_code": " ", "sesa": [{"sc": 53.7701, "total": 65.0054, "mc": 11.2353}], "name": "PRO", "chain": "H", "cv_coarse": [0.602711704963365], "number": 270, "sap_score": [-0.2129300456329797], "cv_fine": [0.7032555686013102], "name_short": "P", "surface": [true], "secondary_structure": ["L"], "chemical_name": "PROLINE", "fasa": [{"sc": 53.491, "total": 53.912, "mc": 0.421}], "id": "H.270. "}, {"ins_code": " ", "sesa": [{"sc": 34.4574, "total": 34.4574, "mc": 0.0}], "name": "LEU", "chain": "H", "cv_coarse": [0.708938921927327], "number": 272, "sap_score": [-0.39511453625920534], "cv_fine": [0.8600926158765342], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 15.402, "total": 15.402, "mc": 0.0}], "id": "H.272. "}, {"ins_code": " ", "sesa": [{"sc": 27.3692, "total": 27.3692, "mc": 0.0}], "name": "ILE", "chain": "H", "cv_coarse": [0.6570214784594648], "number": 274, "sap_score": [0.11604422598087567], "cv_fine": [0.9345920409172017], "name_short": "I", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ISOLEUCINE", "fasa": [{"sc": 10.742, "total": 10.766, "mc": 0.024}], "id": "H.274. "}, {"ins_code": " ", "sesa": [{"sc": 20.072699999999998, "total": 20.072699999999998, "mc": 0.0}], "name": "THR", "chain": "H", "cv_coarse": [0.5099602050730591], "number": 276, "sap_score": [-0.1402002742214806], "cv_fine": [0.9172917192227136], "name_short": "T", "surface": [true], "secondary_structure": ["S"], "chemical_name": "THREONINE", "fasa": [{"sc": 9.362, "total": 9.362, "mc": 0.0}], "id": "H.276. "}, {"ins_code": " ", "sesa": [{"sc": 35.0439, "total": 38.2462, "mc": 3.2023}], "name": "GLU", "chain": "H", "cv_coarse": [0.40136717002165756], "number": 278, "sap_score": [-0.3958963714810535], "cv_fine": [0.7956598234762772], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 30.385, "total": 30.418, "mc": 0.034}], "id": "H.278. "}, {"ins_code": " ", "sesa": [{"sc": 50.4684, "total": 59.480999999999995, "mc": 9.012599999999999}], "name": "MET", "chain": "H", "cv_coarse": [0.28371640034679346], "number": 279, "sap_score": [-0.6918296025836999], "cv_fine": [0.6501520839781508], "name_short": "M", "surface": [true], "secondary_structure": ["L"], "chemical_name": "METHIONINE", "fasa": [{"sc": 57.598, "total": 62.035, "mc": 4.436}], "id": "H.279. "}, {"ins_code": " ", "sesa": [{"sc": 97.4071, "total": 114.0299, "mc": 16.6228}], "name": "ARG", "chain": "H", "cv_coarse": [0.23171350273521096], "number": 280, "sap_score": [-2.6913442679138693], "cv_fine": [0.40336554650846224], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 146.287, "total": 176.587, "mc": 30.3}], "id": "H.280. "}, {"ins_code": " ", "sesa": [{"sc": 48.5923, "total": 71.05099999999999, "mc": 22.4587}], "name": "ASP", "chain": "H", "cv_coarse": [0.29451102727563194], "number": 281, "sap_score": [-3.6230312137756346], "cv_fine": [0.37554137120644826], "name_short": "D", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 76.565, "total": 106.484, "mc": 29.92}], "id": "H.281. "}, {"ins_code": " ", "sesa": [{"sc": 14.9693, "total": 28.269499999999997, "mc": 13.3002}], "name": "GLY", "chain": "H", "cv_coarse": [0.37643313031328385], "number": 282, "sap_score": [-2.770927991877325], "cv_fine": [0.5282266113277971], "name_short": "G", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLYCINE", "fasa": [{"sc": 19.721, "total": 31.724, "mc": 12.003}], "id": "H.282. "}, {"ins_code": " ", "sesa": [{"sc": 75.1943, "total": 77.51599999999999, "mc": 2.3217}], "name": "GLN", "chain": "H", "cv_coarse": [0.34807339990813346], "number": 283, "sap_score": [-1.7555863053710008], "cv_fine": [0.4534289982211269], "name_short": "Q", "surface": [true], "secondary_structure": ["L"], "chemical_name": "GLUTAMINE", "fasa": [{"sc": 123.84, "total": 123.87, "mc": 0.031}], "id": "H.283. "}, {"ins_code": " ", "sesa": [{"sc": 40.1168, "total": 62.392700000000005, "mc": 22.2759}], "name": "VAL", "chain": "H", "cv_coarse": [0.42156361499931566], "number": 284, "sap_score": [0.787731792581287], "cv_fine": [0.7061376932487914], "name_short": "V", "surface": [true], "secondary_structure": ["S"], "chemical_name": "VALINE", "fasa": [{"sc": 31.877, "total": 47.11, "mc": 15.233}], "id": "H.284. "}, {"ins_code": " ", "sesa": [{"sc": 35.311400000000006, "total": 35.311400000000006, "mc": 0.0}], "name": "LEU", "chain": "H", "cv_coarse": [0.3313949819015879], "number": 285, "sap_score": [1.157563718860434], "cv_fine": [0.7409574840227132], "name_short": "L", "surface": [true], "secondary_structure": ["S"], "chemical_name": "LEUCINE", "fasa": [{"sc": 26.262, "total": 26.262, "mc": 0.0}], "id": "H.285. "}, {"ins_code": " ", "sesa": [{"sc": 21.6113, "total": 21.6113, "mc": 0.0}], "name": "ARG", "chain": "H", "cv_coarse": [0.5360025817954287], "number": 287, "sap_score": [-0.36158661121441754], "cv_fine": [0.8640503335446024], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 11.564, "total": 11.564, "mc": 0.0}], "id": "H.287. "}, {"ins_code": " ", "sesa": [{"sc": 39.7663, "total": 39.7663, "mc": 0.0}], "name": "ARG", "chain": "H", "cv_coarse": [0.4619408534820405], "number": 288, "sap_score": [-0.7585189314787671], "cv_fine": [0.7589593354622199], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 32.245, "total": 32.814, "mc": 0.569}], "id": "H.288. "}, {"ins_code": " ", "sesa": [{"sc": 10.0235, "total": 20.2985, "mc": 10.275}], "name": "SER", "chain": "H", "cv_coarse": [0.5774034252090806], "number": 289, "sap_score": [-0.46539137480419585], "cv_fine": [0.8455395317839857], "name_short": "S", "surface": [true], "secondary_structure": ["S"], "chemical_name": "SERINE", "fasa": [{"sc": 3.7, "total": 8.683, "mc": 4.982}], "id": "H.289. "}, {"ins_code": " ", "sesa": [{"sc": 18.92, "total": 18.92, "mc": 0.0}], "name": "PHE", "chain": "H", "cv_coarse": [0.538805613137532], "number": 290, "sap_score": [0.19055343988006174], "cv_fine": [0.926977357621364], "name_short": "F", "surface": [true], "secondary_structure": ["S"], "chemical_name": "PHENYLALANINE", "fasa": [{"sc": 3.9, "total": 3.9, "mc": 0.0}], "id": "H.290. "}, {"ins_code": " ", "sesa": [{"sc": 28.721600000000002, "total": 28.721600000000002, "mc": 0.0}], "name": "GLU", "chain": "H", "cv_coarse": [0.5824474347761153], "number": 291, "sap_score": [-0.5677176393988299], "cv_fine": [0.7855111153262583], "name_short": "E", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 21.942, "total": 21.942, "mc": 0.0}], "id": "H.291. "}, {"ins_code": " ", "sesa": [{"sc": 0.0, "total": 3.4881, "mc": 3.4881}], "name": "GLY", "chain": "H", "cv_coarse": [0.5620590928745932], "number": 292, "sap_score": [-0.12367012597165358], "cv_fine": [0.9579831422121418], "name_short": "G", "surface": [true], "secondary_structure": ["S"], "chemical_name": "GLYCINE", "fasa": [{"sc": 0.443, "total": 0.735, "mc": 0.291}], "id": "H.292. "}, {"ins_code": " ", "sesa": [{"sc": 80.2417, "total": 80.2417, "mc": 0.0}], "name": "ARG", "chain": "H", "cv_coarse": [0.43359721891930075], "number": 293, "sap_score": [-0.990760669991879], "cv_fine": [0.7955850918566334], "name_short": "R", "surface": [true], "secondary_structure": ["S"], "chemical_name": "ARGININE", "fasa": [{"sc": 83.27, "total": 83.27, "mc": 0.0}], "id": "H.293. "}, {"ins_code": " ", "sesa": [{"sc": 16.3948, "total": 16.3948, "mc": 0.0}], "name": "CYS", "chain": "H", "cv_coarse": [0.33544859122483267], "number": 295, "sap_score": [-0.218685138257205], "cv_fine": [0.74285533231092], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 9.529, "total": 9.529, "mc": 0.0}], "id": "H.295. "}, {"ins_code": " ", "sesa": [{"sc": 36.8617, "total": 52.3576, "mc": 15.4959}], "name": "ALA", "chain": "H", "cv_coarse": [0.25654439569908105], "number": 296, "sap_score": [0.37083133477529706], "cv_fine": [0.4820882084009533], "name_short": "A", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ALANINE", "fasa": [{"sc": 58.236, "total": 70.044, "mc": 11.809}], "id": "H.296. "}, {"ins_code": " ", "sesa": [{"sc": 43.9344, "total": 49.3072, "mc": 5.3728}], "name": "CYS", "chain": "H", "cv_coarse": [0.24725291746623582], "number": 297, "sap_score": [-0.15101239438784236], "cv_fine": [0.5743100442039081], "name_short": "C", "surface": [true], "secondary_structure": ["L"], "chemical_name": "CYSTEINE", "fasa": [{"sc": 53.889, "total": 54.251, "mc": 0.362}], "id": "H.297. "}, {"ins_code": " ", "sesa": [{"sc": 8.7725, "total": 8.7725, "mc": 0.0}], "name": "PRO", "chain": "H", "cv_coarse": [0.28067159077507503], "number": 298, "sap_score": [-0.030516305296251434], "cv_fine": [0.8404756036148902], "name_short": "P", "surface": [true], "secondary_structure": ["H"], "chemical_name": "PROLINE", "fasa": [{"sc": 1.975, "total": 1.975, "mc": 0.0}], "id": "H.298. "}, {"ins_code": " ", "sesa": [{"sc": 12.7892, "total": 25.0663, "mc": 12.277099999999999}], "name": "GLY", "chain": "H", "cv_coarse": [0.2351084645034655], "number": 299, "sap_score": [-0.536177834967742], "cv_fine": [0.7609913933654793], "name_short": "G", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLYCINE", "fasa": [{"sc": 4.564, "total": 9.998, "mc": 5.435}], "id": "H.299. "}, {"ins_code": " ", "sesa": [{"sc": 93.139, "total": 99.5147, "mc": 6.3757}], "name": "ARG", "chain": "H", "cv_coarse": [0.22706868802454963], "number": 300, "sap_score": [-1.7217781793838227], "cv_fine": [0.48010101238318603], "name_short": "R", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ARGININE", "fasa": [{"sc": 133.83, "total": 134.643, "mc": 0.813}], "id": "H.300. "}, {"ins_code": " ", "sesa": [{"sc": 32.5684, "total": 32.5684, "mc": 0.0}], "name": "ASP", "chain": "H", "cv_coarse": [0.30745688148608935], "number": 301, "sap_score": [-0.8951329953484786], "cv_fine": [0.7080709428109558], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 18.066, "total": 18.066, "mc": 0.0}], "id": "H.301. "}, {"ins_code": " ", "sesa": [{"sc": 56.224, "total": 56.224, "mc": 0.0}], "name": "ARG", "chain": "H", "cv_coarse": [0.2736635267367619], "number": 302, "sap_score": [-1.372320270727621], "cv_fine": [0.7421024328680434], "name_short": "R", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ARGININE", "fasa": [{"sc": 66.672, "total": 66.672, "mc": 0.0}], "id": "H.302. "}, {"ins_code": " ", "sesa": [{"sc": 78.17179999999999, "total": 81.1004, "mc": 2.9286}], "name": "LYS", "chain": "H", "cv_coarse": [0.21727336453529666], "number": 303, "sap_score": [-1.4419805763273525], "cv_fine": [0.5738752223656638], "name_short": "K", "surface": [true], "secondary_structure": ["H"], "chemical_name": "LYSINE", "fasa": [{"sc": 90.054, "total": 90.67, "mc": 0.616}], "id": "H.303. "}, {"ins_code": " ", "sesa": [{"sc": 34.4417, "total": 43.4345, "mc": 8.992799999999999}], "name": "ALA", "chain": "H", "cv_coarse": [0.2658950162779041], "number": 304, "sap_score": [-2.1018608652795274], "cv_fine": [0.6324860825703104], "name_short": "A", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ALANINE", "fasa": [{"sc": 41.257, "total": 46.319, "mc": 5.062}], "id": "H.304. "}, {"ins_code": " ", "sesa": [{"sc": 50.5234, "total": 57.4373, "mc": 6.9139}], "name": "ASP", "chain": "H", "cv_coarse": [0.340707155828641], "number": 305, "sap_score": [-1.272765780382459], "cv_fine": [0.6833626822136224], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 58.582, "total": 60.596, "mc": 2.014}], "id": "H.305. "}, {"ins_code": " ", "sesa": [{"sc": 38.3246, "total": 42.4298, "mc": 4.1052}], "name": "GLU", "chain": "H", "cv_coarse": [0.2779221390946554], "number": 306, "sap_score": [-1.8476168398678505], "cv_fine": [0.748677742595071], "name_short": "E", "surface": [true], "secondary_structure": ["H"], "chemical_name": "GLUTAMIC ACID", "fasa": [{"sc": 34.714, "total": 35.885, "mc": 1.171}], "id": "H.306. "}, {"ins_code": " ", "sesa": [{"sc": 57.856199999999994, "total": 70.1087, "mc": 12.252500000000001}], "name": "ASP", "chain": "H", "cv_coarse": [0.2224438825739863], "number": 307, "sap_score": [-3.422312145722896], "cv_fine": [0.4796551338830513], "name_short": "D", "surface": [true], "secondary_structure": ["H"], "chemical_name": "ASPARTIC ACID", "fasa": [{"sc": 92.983, "total": 106.851, "mc": 13.868}], "id": "H.307. "}, {"ins_code": " ", "sesa": [{"sc": 84.87219999999999, "total": 98.01490000000001, "mc": 13.1427}], "name": "HIS", "chain": "H", "cv_coarse": [0.28815245185218963], "number": 308, "sap_score": [-2.871356997380092], "cv_fine": [0.3513848044644809], "name_short": "H", "surface": [true], "secondary_structure": ["H"], "chemical_name": "HISTIDINE", "fasa": [{"sc": 151.816, "total": 163.751, "mc": 11.935}], "id": "H.308. "}, {"ins_code": " ", "sesa": [{"sc": 93.56559999999999, "total": 106.39819999999999, "mc": 12.8326}], "name": "TYR", "chain": "H", "cv_coarse": [0.30474941051700083], "number": 309, "sap_score": [0.5019785579314195], "cv_fine": [0.441092039840143], "name_short": "Y", "surface": [true], "secondary_structure": ["H"], "chemical_name": "TYROSINE", "fasa": [{"sc": 133.412, "total": 153.051, "mc": 19.639}], "id": "H.309. "}, {"ins_code": " ", "sesa": [{"sc": 112.126, "total": 138.4751, "mc": 26.3491}], "name": "ARG", "chain": "H", "cv_coarse": [0.21148444183338755], "number": 310, "sap_score": [-4.200540290300941], "cv_fine": [0.32496559626395666], "name_short": "R", "surface": [true], "secondary_structure": ["L"], "chemical_name": "ARGININE", "fasa": [{"sc": 181.583, "total": 231.787, "mc": 50.204}], "id": "H.310. "}], "num_chains": 4}, "num_models": 1, "structure_id": "4g83", "protein_metadata": {"O15350": {"protein_name": "Tumor protein p73", "GO_cellular_component": ["cell junction", "chromatin", "cytosol", "Golgi apparatus", "intracellular membrane-bounded organelle", "nucleoplasm", "nucleus"], "jasparPath": "/JASPAR/logos/MA0861.2.svg", "GO_biological_process": ["DNA-binding transcription activator activity, RNA polymerase II-specific", "DNA-binding transcription factor activity", "DNA-binding transcription factor activity, RNA polymerase II-specific", "DNA-binding transcription factor binding", "identical protein binding", "MDM2/MDM4 family protein binding", "metal ion binding", "p53 binding", "protein kinase binding", "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "RNA polymerase II-specific DNA-binding transcription factor binding", "transcription cis-regulatory region binding", "transcription corepressor binding"], "GO_molecular_function": ["DNA damage response", "intrinsic apoptotic signaling pathway in response to DNA damage", "intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator", "kidney development", "mismatch repair", "negative regulation of cardiac muscle cell proliferation", "negative regulation of cell population proliferation", "negative regulation of neuron differentiation", "positive regulation of apoptotic process", "positive regulation of DNA-templated transcription", "positive regulation of lung ciliated cell differentiation", "positive regulation of MAPK cascade", "positive regulation of oligodendrocyte differentiation", "positive regulation of transcription by RNA polymerase II", "protein tetramerization", "regulation of cell cycle", "regulation of gene expression", "regulation of mitotic cell cycle", "regulation of transcription by RNA polymerase II", "response to organonitrogen compound", "response to xenobiotic stimulus"], "organism": "Homo sapiens"}}}